KEGG   Pyrococcus furiosus COM1: PFC_06635Help
Entry
PFC_06635         CDS       T02183                                 

Definition
formaldehyde:ferredoxin oxidoreductase wor5
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFC_06635
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PFC_06635
Enzymes [BR:pfi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     PFC_06635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1181862..1183736
Genome map
AA seq 624 aa AA seqDB search
MYAYNGKLLDVDLTREKVKEVELSEDVLKKFYGGRGLGTYILWKELGEKWEKVDPLGEEN
LLLILTGPLTGYYPGMKTSIVSKSPESNGVVGSVLSSELGLELKAAGYDGIIIRGKAKSP
VYLFIHNDTVEIRDATKYWGMGGIELYKTLLKEVHEEIRKKEKLKGVPKEPAMIYIGKGG
ENKVRFAAIMTKLMHAAGYGGYGAVMGSKNLKAVIAKGSGPLPEVYDKEKMKVLLREFWK
ELFSMTTFREWGTGAGGYSVGHDRSSEPIRNWQEEYHDNEEISVVNFENRTWIKKYWADY
GCPVNCMKISYLRYGPYKGSISDAPDYELQAYMGTNLGIFEPEKIVYLSYLVDELGLDGI
NTGNILGFAAELYQRGILTKEDLGFELNWGDEKAFAKLLHLIVEKEGIGKILAEGTYRAA
LKISEIKGIDVTKYAVHVKGIAVGAHGIRSELDYTKDISYAVSVQGGDHTSTAALPAKGY
TGELVEAFYDSAVICNFVTKPGFEKIIEFGNALSGFNITPEQWLNEIGLRIIHLQRILLL
LGGPDVYWDPRKDDDNPPRFYEPLPSGPVKGKAPNREDIKAKVKQYYEEIGYDEHGIPKE
EVLEELGIGEAKREVKRIKKRLNL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcatacaatggaaaacttctcgatgtggacttaactagagaaaaagttaaggaa
gttgaactaagtgaagatgttctaaaaaagttctacggcggtagaggactaggaacatat
attctttggaaggagttgggagagaagtgggaaaaagttgaccctcttggagaagaaaat
ctccttttgatcttaactgggccgctaacaggctattacccagggatgaagacttccatt
gtttcaaaatctcccgaaagcaatggagtagttgggagtgtcctaagtagcgaacttgga
ttagaactcaaggctgcaggatacgatggaattataatcagaggtaaagcaaaatccccc
gtatatctcttcatacacaacgatactgtagagataagagacgcaacaaagtactggggt
atgggtggaattgagctctataaaaccctcttaaaagaggttcacgaagagataaggaaa
aaagaaaagctaaaaggagttcctaaggagccagcaatgatatacatagggaaaggaggt
gaaaataaagtccggtttgccgcaataatgacaaagctaatgcacgccgctggatatggc
ggttacggagccgtcatgggtagtaaaaatcttaaggcagttattgcaaagggcagtggg
cccttaccagaagtttatgataaagaaaaaatgaaagttcttctcagagaattctggaag
gagttattctcaatgaccacctttagagagtggggaactggtgctggaggatacagcgta
gggcatgaccggtcaagtgagccgataaggaactggcaagaggagtatcatgacaatgaa
gagataagcgttgtcaactttgagaatagaacgtggataaagaagtattgggcagactat
ggatgtccagtcaactgtatgaagatttcctacctaagatacggtccctacaaaggttca
attagcgatgccccagattatgagcttcaagcttatatggggacaaacctgggaatattt
gagccagagaaaattgtttacctttcatacctcgttgatgaactaggtttagatgggata
aacaccggaaacatcttgggattcgcagcagagctctaccaaagaggaattctaaccaaa
gaagaccttggatttgagctcaactggggagatgaaaaggcgtttgcaaagcttttgcac
ctgatagtggaaaaagaaggaataggaaaaatacttgcagagggaacctacagagcagct
ctaaagatttcagaaattaaaggaatcgatgtaactaagtatgcagttcacgtgaaggga
attgctgtaggagctcacggaataaggagcgaacttgactatactaaagacataagctat
gcagtttcggttcaagggggcgatcacacctcaactgcagcccttccagcaaagggatat
acaggagagctagttgaagcattttatgactcagcggtaatatgcaacttcgtcacaaag
cccgggtttgagaaaataattgagtttggaaatgctctcagtggattcaacattactcca
gagcagtggcttaatgaaattggcctaagaatcatccaccttcagagaatactccttctc
ttaggcggaccagatgtgtattgggatccaagaaaagacgacgacaatccaccaagattc
tatgaaccactcccaagtggtcctgtcaaaggaaaggcacccaacagggaggatataaag
gcaaaggttaagcaatattatgaggaaattggctacgacgaacatggaattccaaaggag
gaagttttggaagagcttggcattggcgaggccaaaagggaagttaagaggattaagaag
cgcctaaatctttaa

DBGET integrated database retrieval system