KEGG   Pyrococcus furiosus COM1: PFC_06635Help
Entry
PFC_06635         CDS       T02183                                 

Definition
formaldehyde:ferredoxin oxidoreductase wor5
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pfi01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pfi00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1181862..1183736
Genome map
AA seq 624 aa AA seqDB search
MYAYNGKLLDVDLTREKVKEVELSEDVLKKFYGGRGLGTYILWKELGEKWEKVDPLGEEN
LLLILTGPLTGYYPGMKTSIVSKSPESNGVVGSVLSSELGLELKAAGYDGIIIRGKAKSP
VYLFIHNDTVEIRDATKYWGMGGIELYKTLLKEVHEEIRKKEKLKGVPKEPAMIYIGKGG
ENKVRFAAIMTKLMHAAGYGGYGAVMGSKNLKAVIAKGSGPLPEVYDKEKMKVLLREFWK
ELFSMTTFREWGTGAGGYSVGHDRSSEPIRNWQEEYHDNEEISVVNFENRTWIKKYWADY
GCPVNCMKISYLRYGPYKGSISDAPDYELQAYMGTNLGIFEPEKIVYLSYLVDELGLDGI
NTGNILGFAAELYQRGILTKEDLGFELNWGDEKAFAKLLHLIVEKEGIGKILAEGTYRAA
LKISEIKGIDVTKYAVHVKGIAVGAHGIRSELDYTKDISYAVSVQGGDHTSTAALPAKGY
TGELVEAFYDSAVICNFVTKPGFEKIIEFGNALSGFNITPEQWLNEIGLRIIHLQRILLL
LGGPDVYWDPRKDDDNPPRFYEPLPSGPVKGKAPNREDIKAKVKQYYEEIGYDEHGIPKE
EVLEELGIGEAKREVKRIKKRLNL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcatacaatggaaaacttctcgatgtggacttaactagagaaaaagttaaggaa
gttgaactaagtgaagatgttctaaaaaagttctacggcggtagaggactaggaacatat
attctttggaaggagttgggagagaagtgggaaaaagttgaccctcttggagaagaaaat
ctccttttgatcttaactgggccgctaacaggctattacccagggatgaagacttccatt
gtttcaaaatctcccgaaagcaatggagtagttgggagtgtcctaagtagcgaacttgga
ttagaactcaaggctgcaggatacgatggaattataatcagaggtaaagcaaaatccccc
gtatatctcttcatacacaacgatactgtagagataagagacgcaacaaagtactggggt
atgggtggaattgagctctataaaaccctcttaaaagaggttcacgaagagataaggaaa
aaagaaaagctaaaaggagttcctaaggagccagcaatgatatacatagggaaaggaggt
gaaaataaagtccggtttgccgcaataatgacaaagctaatgcacgccgctggatatggc
ggttacggagccgtcatgggtagtaaaaatcttaaggcagttattgcaaagggcagtggg
cccttaccagaagtttatgataaagaaaaaatgaaagttcttctcagagaattctggaag
gagttattctcaatgaccacctttagagagtggggaactggtgctggaggatacagcgta
gggcatgaccggtcaagtgagccgataaggaactggcaagaggagtatcatgacaatgaa
gagataagcgttgtcaactttgagaatagaacgtggataaagaagtattgggcagactat
ggatgtccagtcaactgtatgaagatttcctacctaagatacggtccctacaaaggttca
attagcgatgccccagattatgagcttcaagcttatatggggacaaacctgggaatattt
gagccagagaaaattgtttacctttcatacctcgttgatgaactaggtttagatgggata
aacaccggaaacatcttgggattcgcagcagagctctaccaaagaggaattctaaccaaa
gaagaccttggatttgagctcaactggggagatgaaaaggcgtttgcaaagcttttgcac
ctgatagtggaaaaagaaggaataggaaaaatacttgcagagggaacctacagagcagct
ctaaagatttcagaaattaaaggaatcgatgtaactaagtatgcagttcacgtgaaggga
attgctgtaggagctcacggaataaggagcgaacttgactatactaaagacataagctat
gcagtttcggttcaagggggcgatcacacctcaactgcagcccttccagcaaagggatat
acaggagagctagttgaagcattttatgactcagcggtaatatgcaacttcgtcacaaag
cccgggtttgagaaaataattgagtttggaaatgctctcagtggattcaacattactcca
gagcagtggcttaatgaaattggcctaagaatcatccaccttcagagaatactccttctc
ttaggcggaccagatgtgtattgggatccaagaaaagacgacgacaatccaccaagattc
tatgaaccactcccaagtggtcctgtcaaaggaaaggcacccaacagggaggatataaag
gcaaaggttaagcaatattatgaggaaattggctacgacgaacatggaattccaaaggag
gaagttttggaagagcttggcattggcgaggccaaaagggaagttaagaggattaagaag
cgcctaaatctttaa

DBGET integrated database retrieval system