KEGG   Pyrococcus furiosus COM1: PFC_06965Help
Entry
PFC_06965         CDS       T02183                                 

Definition
(GenBank) endoglucanase
  KO
K20608  
tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
pfi  Pyrococcus furiosus COM1
Brite
Enzymes [BR:pfi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     PFC_06965
Peptidases [BR:pfi01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   PFC_06965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1242913..1243959)
Genome map
AA seq 348 aa AA seqDB search
MVDYELLKKVVEAPGVSGYEFMGIRDVVIEEIKDYVDEVNVDKLGNVIAHKKGEGPKVMI
AAHMDQIGLMVTHIEKNGFLRVAPIGGIDPRTLIAQRFKVWIDKGKFIYGVGGSVPPHIQ
KPEDRKKAPDWDQIFIDIGAESKEEAEELGVKIGTIVTWDGRLERLGKHRFVSIAFDDRI
AVYTLIETARQLQDTKADIYFVATVQEEVGLRGARTSAFGINPDYGFAIDVTIAADVPGT
PEHKQVTQLGKGTAIKIMDRSVICHPTIVRWMEELAKKYEIPYQWDILLGGGTDAGAIHL
TRAGVPTGAVSIPARYIHSNAEVVDERDVDASVKLMVKVLEHIHELKI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtggactatgagcttttaaaaaaggtagtagaggctccgggagtttcaggatatgag
ttcatgggaattagagatgtcgttattgaagagataaaggactatgtggatgaagtaaat
gtagacaaactcggaaacgttattgctcacaagaaaggggaaggtccaaaagtaatgata
gcggcccatatggatcaaattggactgatggtcacgcatatagaaaagaatggatttctc
agagttgctccaataggaggaatagatccaaggacattaattgctcagaggtttaaagtt
tggatagacaaaggaaagtttatctacggagttggaggtagtgttcctccacacatacag
aagcctgaagataggaagaaagctccagattgggatcagatattcatagacattggagca
gagagcaaggaagaggccgaggagttgggagtaaaaataggaacaatagtaacctgggat
gggagacttgagaggctggggaaacacagatttgtcagcatagcatttgacgataggata
gctgtatacactttaattgaaactgcaagacagcttcaagatacgaaggcagatatctac
tttgtggccacagtgcaggaggaggttgggttaagaggtgcgaggacaagtgcctttgga
attaatcccgattatggttttgccattgatgttactatagctgcagatgtaccaggaaca
ccagagcacaagcaagttactcaacttggaaagggcactgcaatcaagataatggatcgt
tcagtaatctgccatccaacaattgttaggtggatggaggaactggcaaagaagtacgag
attccttaccagtgggatattctgctgggaggaggtacagacgctggggctattcactta
actagggctggagttccaacaggtgctgtaagtattcctgcacgatacatacactcaaat
gcagaggttgtagatgagagagacgttgatgcaagtgtaaagttgatggtaaaagttctt
gaacatatacacgagctaaagatttaa

DBGET integrated database retrieval system