KEGG   Pyrococcus furiosus COM1: PFC_07190Help
Entry
PFC_07190         CDS       T02183                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PFC_07190
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFC_07190
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PFC_07190
Enzymes [BR:pfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PFC_07190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1284447..1285787
Genome map
AA seq 446 aa AA seqDB search
MKVVLPDGRIPRRWYNILPDLPEPLAPPLDPETNEPVDPKKLERIFAKELVKQEMSTKRY
IKIPEEVRKMYSKIGRPTPLFRATNLEKYLNTPARIYFKFEGATVTGSHKINTALAQAYY
AKKEGIERLVTETGAGQWGTALSLAGALMGIKVRVYMARASYEQKPYRKVLMRIYGAEVF
PSPSENTEIGKRFLSENPNHPGSLGIAISEAIEDVLKDEKARYSLGSVLNHVLMHQTVIG
LEAKQQMEEFEEPDVIIGCVGGGSNFAGLAYPFVKEVLDGDNEYEFIAVEPKAAPSMTRG
VYTYDFGDSGELTPKLKMHTLGHRYHVPPIHAGGLRYHGVAPTLSVLVNNGIVKPIAYHQ
TEVFEAAALFAKLEGIVPAPESAHAIKATIDKAIEAKREGKEIVILFNLSGHGLLDLHGY
EEYLEGRLQDYEPKDLPISNPLNPKP
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagttcttccagacggtagaatacctaggagatggtataatatactccccgat
ttaccggaacccttagctcccccattggatccagagacaaatgaacccgtagaccccaag
aagttggagaggatatttgcgaaagaactagttaagcaggaaatgagcacaaagagatac
ataaaaattcccgaagaagttagaaagatgtattctaaaatagggaggcctacacctctt
ttcagagctacaaacctcgaaaaatacctaaatactcctgcaaggatttacttcaagttt
gagggagcaacagttacaggaagccacaaaatcaatactgccttagctcaggcatattat
gcaaagaaggaaggaatagagaggctagttactgaaactggagctggtcaatggggaact
gcattgagcttggctggagccttgatgggcattaaggttagagtatatatggcaagagca
agttacgagcagaagccatatagaaaagttttaatgaggatttatggagcagaggtattc
ccaagtcccagcgagaatactgaaataggaaaaagattcctaagtgaaaatccaaaccac
ccaggaagcttaggtattgcaattagtgaggcaatagaagatgtactaaaagatgaaaag
gcaagatactccctaggaagtgttctaaaccacgtactaatgcatcaaacggtaattgga
cttgaagcaaagcagcaaatggaagagtttgaggagcccgatgttataataggatgtgtt
ggtggaggaagcaactttgccggtcttgcttatccctttgtaaaagaagtccttgacgga
gacaatgaatacgaatttatagcagtagagccaaaagctgctccttcaatgactagagga
gtctacacttacgattttggggattctggagagctaacccctaagttaaagatgcatact
cttgggcatagataccatgttccccccatacatgctggaggattaagatatcacggagtt
gcacctactttaagtgtactcgttaacaatggaatcgttaagccaatagcttaccatcaa
acagaagtttttgaagctgcagcgttatttgctaagcttgaaggtattgttccagctcca
gaaagtgcccatgcaataaaggccacaatagacaaagccatcgaggctaagagagaagga
aaagaaattgtcatcttgttcaacttaagcggccacggcctactagatctccatggatac
gaagaatacttggagggaaggctccaagactacgagcctaaagatcttcccatatcaaac
cccttgaatcctaaaccttag

DBGET integrated database retrieval system