KEGG   Pyrococcus furiosus COM1: PFC_07665Help
Entry
PFC_07665         CDS       T02183                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pfi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1382449..1383018)
Genome map
AA seq 189 aa AA seqDB search
MRNIKAKLIHYSKLAHRKGLTGSFGGNMSIRVGNYVFIKGTGSVMEELTESQIAVVKLDG
KVVSSVRPSSEYRLHLGVYRNRPEVRAVVHLHPPYSIVLSIFEREAPMITPEAELYLKKV
PVLPFRPAGSVELAQQVSEAMKGYDAVVLERHGVVTVGRSLREAFYKAELVEEVARLWYQ
KFIASREKN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacattaaggcgaagcttatacattattcaaagcttgcacatagaaaaggctta
actggttcatttggaggaaacatgagcattagagttgggaactacgtgttcataaagggg
actggaagcgtgatggaagagcttaccgaaagtcagattgctgttgtaaaattggatggg
aaagtggtttcttctgtaagaccctcctccgaataccgccttcacttgggagtttatagg
aataggcccgaagttagggcagtagttcatcttcatcctccttactccatagtcctctct
atttttgagagggaggctcctatgataacccctgaggctgagttatatcttaagaaagtc
cccgtgcttccatttagacctgcagggagtgttgaattggctcaacaagtctctgaagct
atgaagggttatgatgcagttgtacttgaaagacatggggttgttacagttggaagaagc
cttagagaggccttttataaggctgaactcgttgaggaagtggctagactctggtaccaa
aagtttatagcctccagagagaaaaactaa

DBGET integrated database retrieval system