KEGG   Pyrococcus furiosus COM1: PFC_08055Help
Entry
PFC_08055         CDS       T02183                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00260  Glycine, serine and threonine metabolism
pfi00750  Vitamin B6 metabolism
pfi01100  Metabolic pathways
pfi01110  Biosynthesis of secondary metabolites
pfi01120  Microbial metabolism in diverse environments
pfi01230  Biosynthesis of amino acids
Module
pfi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFC_08055
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PFC_08055
Enzymes [BR:pfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PFC_08055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFN04543
UniProt: I6V325
Position
1456769..1457671
Genome map
AA seq 300 aa AA seqDB search
MDNETDPEGSPLLRAMKLEEKLNISKIYLKLEMHNPTRTHKDRIAKAHVKQAKDLGFSGI
TVGTCGNYGVAIAYFAKKEGIKAVIFVPRQYRNSRVEEMKEYGADVIFVDGAYEEAVLMS
KIFAKTMNYYDANPGTQPAVDYEAYSLISKEILEEIEPYAVFVPVGNGSTLAGIYYGFKK
YGVMPRIIGVTTSYGNQVLNAFYTGRVEEVKDFVETDFNEPLVSSISFDLQNALEAIKDS
NGYIFGFGDDTALKYAKILEMSEGIKALPASTLTLVGLVKFVRKFGVNNENFVLLLTGGI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggataacgagacagatcccgaaggatccccattattgagggctatgaagttagaggag
aaactgaacatctccaagatatacttaaaacttgaaatgcacaatcctacgagaactcac
aaagatagaatagctaaagctcacgttaagcaggcgaaagatcttggcttttctggaatt
actgtaggaacttgtggtaattacggagtagctatagcatactttgctaagaaggaaggg
ataaaagcggtaatttttgttccaaggcagtataggaattcaagggtagaagaaatgaag
gagtatggagcagatgtcatatttgtagatggagcgtacgaagaggcagttctcatgagc
aaaatatttgcaaaaactatgaactattacgatgcaaacccaggaacacagcctgcagtt
gattatgaagcttattccttaatttcaaaggaaatcctggaagaaatagagccatatgcg
gtatttgttcccgtaggaaacggctccacactagctggaatttattatggattcaaaaaa
tatggagttatgcctaggataattggggtcacaactagctatggaaaccaagtgctcaac
gctttctatacaggaagagttgaagaagtaaaagacttcgttgagactgattttaatgag
cccctcgtttcctcgatatccttcgatttgcagaatgcgctcgaagccataaaagattct
aacggctatatttttggttttggtgatgatacagcattaaaatatgcaaagattttggag
atgagtgaggggataaaagcacttccagcttccactctaactttagttggacttgttaaa
tttgtgagaaaatttggcgtgaataatgagaattttgtgttgctcctaactggagggatt
tga

DBGET integrated database retrieval system