KEGG   Pyrococcus furiosus COM1: PFC_08055Help
Entry
PFC_08055         CDS       T02183                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PFC_08055
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFC_08055
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PFC_08055
Enzymes [BR:pfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PFC_08055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1456769..1457671
Genome map
AA seq 300 aa AA seqDB search
MDNETDPEGSPLLRAMKLEEKLNISKIYLKLEMHNPTRTHKDRIAKAHVKQAKDLGFSGI
TVGTCGNYGVAIAYFAKKEGIKAVIFVPRQYRNSRVEEMKEYGADVIFVDGAYEEAVLMS
KIFAKTMNYYDANPGTQPAVDYEAYSLISKEILEEIEPYAVFVPVGNGSTLAGIYYGFKK
YGVMPRIIGVTTSYGNQVLNAFYTGRVEEVKDFVETDFNEPLVSSISFDLQNALEAIKDS
NGYIFGFGDDTALKYAKILEMSEGIKALPASTLTLVGLVKFVRKFGVNNENFVLLLTGGI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggataacgagacagatcccgaaggatccccattattgagggctatgaagttagaggag
aaactgaacatctccaagatatacttaaaacttgaaatgcacaatcctacgagaactcac
aaagatagaatagctaaagctcacgttaagcaggcgaaagatcttggcttttctggaatt
actgtaggaacttgtggtaattacggagtagctatagcatactttgctaagaaggaaggg
ataaaagcggtaatttttgttccaaggcagtataggaattcaagggtagaagaaatgaag
gagtatggagcagatgtcatatttgtagatggagcgtacgaagaggcagttctcatgagc
aaaatatttgcaaaaactatgaactattacgatgcaaacccaggaacacagcctgcagtt
gattatgaagcttattccttaatttcaaaggaaatcctggaagaaatagagccatatgcg
gtatttgttcccgtaggaaacggctccacactagctggaatttattatggattcaaaaaa
tatggagttatgcctaggataattggggtcacaactagctatggaaaccaagtgctcaac
gctttctatacaggaagagttgaagaagtaaaagacttcgttgagactgattttaatgag
cccctcgtttcctcgatatccttcgatttgcagaatgcgctcgaagccataaaagattct
aacggctatatttttggttttggtgatgatacagcattaaaatatgcaaagattttggag
atgagtgaggggataaaagcacttccagcttccactctaactttagttggacttgttaaa
tttgtgagaaaatttggcgtgaataatgagaattttgtgttgctcctaactggagggatt
tga

DBGET integrated database retrieval system