KEGG   Pyrococcus furiosus COM1: PFC_08160Help
Entry
PFC_08160         CDS       T02183                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Orthology
K01505  
1-aminocyclopropane-1-carboxylate deaminase [EC:3.5.99.7]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PFC_08160
Enzymes [BR:pfi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.7  1-aminocyclopropane-1-carboxylate deaminase
     PFC_08160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1484310..1485299)
Genome map
AA seq 329 aa AA seqDB search
MHPKVQSLLSKFPRVELIPWETPIQYLPNISKLVGADIYVKRDDLTGLGIGGNKIRKLEY
LLGDAIIRKADVIITVGAVHSNHAFVTGLAAKKLGFDVVLVLRGKEELRGNYLLDKIMGI
ETRVYEAKDSFELMKYAEEVAKELEEKGRKPYIIPVGGASPVGTLGYVRASGEIAEQGNR
IGVNFDSIVVATGSGGTLAGLSVGLAILRKETRAIGMAVGKFGETMVNKVEELAKATGEF
IGVKNLKLKIELYDYSFGEYGKITREVAETIRLVGTKEGVILDPVYTGKAFYGLLDLAKK
GELGEKILFIHTGGISGTFHYGDKILSFL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcatccaaaagttcaatctcttctatcaaaattccctagagttgaattaatcccatgg
gaaacaccaattcaatatttgcctaacataagcaaacttgtaggggctgatatttacgtc
aaaagggacgacctcacagggcttggaatcggagggaacaaaattagaaaactggaatac
ctgctgggagatgcaataataagaaaagccgatgtaataataactgtaggtgctgtacac
tcaaaccacgcgtttgtaacaggcttggcagcaaaaaagttagggtttgatgtagttcta
gttttaagaggaaaggaagaattaaggggaaactacctgctggacaaaatcatggggata
gaaacgagagtttatgaagctaaagattcttttgaacttatgaaatatgctgaggaagtt
gccaaagaactagaagaaaagggaagaaagccatatataatacctgtcggaggagcttct
ccggtcggaacattgggttatgttagagctagtggagagatcgcagagcagggaaataga
attggagttaactttgacagcattgtcgttgcaacgggtagcggaggtacactagctgga
ctatctgtaggattggcaattttaaggaaggaaacaagggcaattggtatggcagttgga
aagtttggagagacgatggttaataaagtggaagaacttgcaaaagcaactggagagttc
atcggagtgaaaaatttaaagctaaaaattgagctctatgattacagctttggagaatat
ggaaaaataacaagggaagttgcagaaaccattaggctagtcggaacaaaagaaggggta
atcttagaccctgtctatactggaaaagcattctacggattacttgatctcgctaaaaaa
ggagaattaggggagaaaatactgtttattcacaccggaggaatctctggaacattccat
tatggggacaagatactctcattcctttag

  All links  
No link information was found.   
DBGET integrated database retrieval system