KEGG   Pyrococcus furiosus COM1: PFC_08320Help
Entry
PFC_08320         CDS       T02183                                 

Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfi01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pfi00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1513296..1514606)
Genome map
AA seq 436 aa AA seqDB search
MDVLELLSQLVEFETVNDPAKGIKPTKECPKFIKDTLEEWEVEADVFEENGYYGVLGEIG
KGYPKLLFMAHFDVVPVNPEEWNTDPFKLTIIGNKAYGRGSVDDKGNVAAVMVALKELAK
EDIKGKIIFAFTGDEEIGGFLASKIAERLKEENKLPKYMINADGIGMKPIIRRRKGFGAV
IRVPIKKIKVKGKIKSKTFKVNTPILETRHAAYFLPGVDTHPLIAASHFVRTKEVPVVSL
EGKFLKGNVVPSEVTLTYLERGDGEEVEVDLGLTELMRSIVPVVRAPIKAEKYSDYGVSI
TPNMYSIENEKHVLRLDIRAMSNSKEDIEKTLKEVISFTLPEGELEVKTNEKAGYLFTSP
EEKIVKVALEVLRELGEDVKPVEGPGASDSRYFTPYGVKAIDIGPKGGNIHGPNEFVEID
SLKKMPKVYKEIALRL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgcttgaacttctttctcaattggttgagttcgaaaccgttaatgatccagca
aagggaataaaacccaccaaagaatgtcccaagttcatcaaagatacgctggaagagtgg
gaagttgaagctgacgtttttgaagagaacggctattatggagtattaggggaaattgga
aaaggttatccaaagctcctcttcatggctcacttcgacgtagtcccagtaaatccagaa
gagtggaacacagatccattcaaattaaccataataggaaacaaagcgtatggaagggga
agcgttgatgataaagggaatgttgctgcggtgatggtagcactaaaagagcttgcaaaa
gaagatatcaaaggaaaaataatctttgcctttactggagatgaagaaattggaggattc
ctcgctagcaagattgctgagagattaaaagaagagaacaagctaccaaagtacatgatc
aatgcagacggaataggaatgaaaccaataattaggagaagaaaggggtttggagcggtt
attagagttccgattaagaagatcaaggttaaagggaaaataaaatccaaaacattcaag
gtaaacaccccaattttagaaacaagacatgctgcatattttctcccaggagtagacact
catccactaatagcagcttcacacttcgtaagaacaaaagaagtccctgtagtttccctt
gaggggaaattcttgaaaggtaacgttgttcccagtgaagttactttaacttaccttgaa
agaggagatggagaagaagttgaagtggaccttggattgacagagctgatgaggtcaata
gttccagttgtgagggctccaataaaggcggaaaaatacagcgactatggagtgtcaata
acgccaaacatgtattccatcgaaaacgaaaaacacgttttaaggctcgatataagggcg
atgagtaattcaaaagaagatatcgaaaagacattaaaagaagttatctcgttcactttg
ccagagggagaactcgaagtcaaaactaacgaaaaagcaggttatctcttcacaagtcct
gaagaaaagatcgtgaaagttgcattggaagttctcagagagcttggcgaagatgttaaa
ccagttgagggtcctggagcctcagattcaaggtacttcaccccatatggcgtaaaggca
atagatatcgggcctaaaggaggaaatatccacggacctaatgaattcgttgaaatagac
tccctaaaaaagatgccaaaagtgtataaggaaattgcactaaggctttga

DBGET integrated database retrieval system