KEGG   Pyrococcus furiosus COM1: PFC_08795Help
Entry
PFC_08795         CDS       T02183                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00330  Arginine and proline metabolism
pfi01100  Metabolic pathways
Module
pfi_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PFC_08795
Enzymes [BR:pfi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PFC_08795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase B12-binding DUF2970
Motif
Other DBs
NCBI-ProteinID: AFN04684
UniProt: I6TYV2
Position
complement(1595090..1595950)
Genome map
AA seq 286 aa AA seqDB search
MLLHTYKSFDMELPLVNIKDADYVILGLPYDGTTSYKPGARFGPVLIRQATLNFESYILD
YDVDLAEAKIADAGDVALPVSIEEALKVAEETVRELREINPKALPIFLGGEHSMTLAPVR
VLKPKSYVVFDAHLDLRDSYGGSKFNHACVARRINELRVEVAIFGVRSGTKEEVDFARKN
GIEWIHARDYSFEAFVDIVSTLPEPIYLSIDIDTFDASLVPETGTPEPGGLRFWDVVEAL
EWLSESREVIGIDIMEVGGEKLGNVTALTGAKLLFYLLGMFEGIKK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgctgttacatacctacaaatcatttgatatggaactgccactagtcaacataaaagat
gccgactacgtgattctgggccttccctatgatgggactacaagctataagccaggtgca
aggtttggtccagttttaataaggcaagctactctaaattttgagagctacattttggat
tatgacgttgatttagccgaagctaagatagctgacgctggagatgtagcactacctgtg
agtatagaagaggcactaaaggtcgctgaggaaactgtgagagagttgagagaaataaat
cccaaagctttgccaatattcctaggtggagagcattctatgacgctagccccagtaaga
gtcctcaaacctaagagttatgtagtctttgatgcgcatttggacttaagagacagctac
gggggttcaaagttcaaccatgcttgtgttgctagaagaataaatgagttgagagtagaa
gtggcaatatttggagtgaggagtgggactaaggaggaggtggattttgcacggaaaaac
ggaatagagtggattcatgcaagagactacagctttgaagcgtttgtagatattgttagc
actctaccagagcccatatacctttcaattgacatagataccttcgatgcatctctagtt
cctgaaactggaaccccagagcctggaggattaagattctgggacgttgtggaagcttta
gaatggttatcagagagcagggaagtcattgggatagatataatggaagttggaggagaa
aagctgggcaatgtaacagccttaactggggcaaagctcctcttctacctcctgggaatg
ttcgaggggattaagaaatga

DBGET integrated database retrieval system