KEGG   Pyrococcus furiosus COM1: PFC_08975Help
Entry
PFC_08975         CDS       T02183                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pfi  Pyrococcus furiosus COM1
Brite
Enzymes [BR:pfi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PFC_08975 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1630872..1631636
Genome map
AA seq 254 aa AA seqDB search
MAPVRIVPFLLEFIKIILEQTKNIVMHLYSSDFPLMMDEKELYEKWMRTVEMLKAEGIIR
SKEVERAFLKYPRYLFVEDKYKKYAHIDEPLPIPAGQTVSAPHMVAIMLEIANLKPGMNI
LEVGTGSGWNAALISEIVKTDVYTIERIPELVEFAKRNLERAGVKNVHVILGDGSKGFPP
KAPYDVIIVTAGAPKIPEPLIEQLKIGGKLIIPVGSYHLWQELLEVRKTKDGIKIKNHGG
VAFVPLIGEYGWKE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcacctgtcagaattgtaccttttctgctggaatttataaagattattttggaacaa
acaaagaatatagtaatgcatttatactcttcagattttcctctaatgatggatgagaaa
gaactttacgaaaagtggatgcgaacagtggaaatgttgaaggctgagggaataattaga
agtaaggaagtggagcgagcatttctaaaataccctcgatacttgtttgtggaagataag
tacaaaaaatacgctcacattgatgagcctcttccaattccagcaggccagacagtctcg
gctcctcatatggtggcaataatgcttgagatcgctaatctaaaacctggaatgaatatt
cttgaagtgggaactggaagtgggtggaatgctgccttgatttctgaaatagtcaaaacg
gatgtatacacaatagaaaggatccctgaacttgtggaatttgcaaaaagaaacttggag
agagcaggcgtaaagaatgttcatgtaattttgggagatgggagtaaaggatttcctccc
aaggctccctatgatgttattatcgtcacagctggtgctccaaagattcccgaaccactt
attgaacagttaaaaattggtggaaagttgataattcctgtaggtagctatcacctctgg
caagagcttttagaagttaggaaaactaaagatggcattaagatcaaaaaccatggtggg
gtagccttcgttcctttaataggggaatacgggtggaaagaatga

DBGET integrated database retrieval system