KEGG   Pyrococcus furiosus COM1: PFC_08985Help
Entry
PFC_08985         CDS       T02183                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00010  Glycolysis / Gluconeogenesis
pfi00051  Fructose and mannose metabolism
pfi00562  Inositol phosphate metabolism
pfi01100  Metabolic pathways
pfi01110  Biosynthesis of secondary metabolites
pfi01120  Microbial metabolism in diverse environments
pfi01130  Biosynthesis of antibiotics
pfi01200  Carbon metabolism
pfi01230  Biosynthesis of amino acids
Module
pfi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pfi_M00002  Glycolysis, core module involving three-carbon compounds
pfi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFC_08985
   00051 Fructose and mannose metabolism
    PFC_08985
   00562 Inositol phosphate metabolism
    PFC_08985
Enzymes [BR:pfi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PFC_08985
Exosome [BR:pfi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PFC_08985
  Exosomal proteins of bladder cancer cells
   PFC_08985
  Exosomal proteins of melanoma cells
   PFC_08985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh IGPS DHO_dh B12-binding His_biosynth NanE RNA_pol_inhib
Motif
Other DBs
NCBI-ProteinID: AFN04720
UniProt: I6V140
Position
1632285..1632971
Genome map
AA seq 228 aa AA seqDB search
MAKLKEPIIAINFKTYIEATGKRALEIAKAAEKVYKETGVTIVVAPQLVDLRMIAESVEI
PVFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMT
MVCSNNPAVSAAVAALNPDYVAVEPPELIGTGIPVSKAKPEVITNTVELVKKVNPEVKVL
CGAGISTGEDVKKAIELGTVGVLLASGVTKAKDPEKAIWDLVSGIIKE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctaaactcaaggagccaattatagcaatcaattttaagacgtacatagaggcaact
ggaaaaagggctttagaaatagcaaaggccgctgaaaaagtgtacaaagaaacaggtgta
acaattgtggttgctccccagcttgtagatctaagaatgattgccgaaagcgttgaaata
cctgtattcgctcaacatatagacccgataaaacctgggagtcatactggacacgttctt
cctgaggctgtgaaggaagctggagcggtagggactctcctcaatcactctgagaataga
atgatccttgcagatctcgaggctgcaataaggagggccgaagaagtaggtctaatgaca
atggtctgctctaataatcctgctgtatcggcggctgtagccgctttgaacccagattat
gttgctgtagagcctcctgagttgataggaactggtatcccagtcagtaaggccaagcct
gaagtgataaccaacacagtggagttggttaagaaggtaaatcctgaggttaaggttctt
tgtggagctggaatatccacgggagaagacgttaagaaggcaatagagcttggaacggta
ggggttcttttagcaagtggagtaacaaaagcaaaagatccagagaaggcgatatgggat
cttgtttcgggaataattaaggagtag

DBGET integrated database retrieval system