KEGG   Pyrococcus furiosus COM1: PFC_08985Help
Entry
PFC_08985         CDS       T02183                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFC_08985
   01230 Biosynthesis of amino acids
    PFC_08985
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFC_08985
   00051 Fructose and mannose metabolism
    PFC_08985
   00562 Inositol phosphate metabolism
    PFC_08985
Enzymes [BR:pfi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PFC_08985
Exosome [BR:pfi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PFC_08985
  Exosomal proteins of bladder cancer cells
   PFC_08985
  Exosomal proteins of melanoma cells
   PFC_08985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1632285..1632971
Genome map
AA seq 228 aa AA seqDB search
MAKLKEPIIAINFKTYIEATGKRALEIAKAAEKVYKETGVTIVVAPQLVDLRMIAESVEI
PVFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMT
MVCSNNPAVSAAVAALNPDYVAVEPPELIGTGIPVSKAKPEVITNTVELVKKVNPEVKVL
CGAGISTGEDVKKAIELGTVGVLLASGVTKAKDPEKAIWDLVSGIIKE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctaaactcaaggagccaattatagcaatcaattttaagacgtacatagaggcaact
ggaaaaagggctttagaaatagcaaaggccgctgaaaaagtgtacaaagaaacaggtgta
acaattgtggttgctccccagcttgtagatctaagaatgattgccgaaagcgttgaaata
cctgtattcgctcaacatatagacccgataaaacctgggagtcatactggacacgttctt
cctgaggctgtgaaggaagctggagcggtagggactctcctcaatcactctgagaataga
atgatccttgcagatctcgaggctgcaataaggagggccgaagaagtaggtctaatgaca
atggtctgctctaataatcctgctgtatcggcggctgtagccgctttgaacccagattat
gttgctgtagagcctcctgagttgataggaactggtatcccagtcagtaaggccaagcct
gaagtgataaccaacacagtggagttggttaagaaggtaaatcctgaggttaaggttctt
tgtggagctggaatatccacgggagaagacgttaagaaggcaatagagcttggaacggta
ggggttcttttagcaagtggagtaacaaaagcaaaagatccagagaaggcgatatgggat
cttgtttcgggaataattaaggagtag

DBGET integrated database retrieval system