KEGG   Pyrococcus furiosus COM1: PFC_09080Help
Entry
PFC_09080         CDS       T02183                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pfi  Pyrococcus furiosus COM1
Brite
Enzymes [BR:pfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PFC_09080
Transfer RNA biogenesis [BR:pfi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    PFC_09080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1652226..1654013)
Genome map
AA seq 595 aa AA seqDB search
MYEEMSDEAFKAAIEEIVNALLSGEIKSREELERIKVEVAKKYHLPKFPKNSDIWKALPK
DAREKFRDLLKKKPTRTISGVAVVAMMTKPFPCPHGRCIYCPGGPAVGSPQSYTGKEPSA
LRASQYAYHPYIIMMARLKQLYDIGHPIDKVEVIIQGGTFPATDLDYQEWYIKCAFKAMN
DFWYFKDIENLEEKLVRLILLKDESVLNEDPKFRKAWEKTHKKKFYYLEEEQKKNEKAKV
RMVGLTIETRPDWAFERQIDRMLAFGTTRVELGVQTIFNFIHERVGRGHGVEEIIKATQL
LRDAGLKINYHIMPGLPGSNFERDLYVFKTIFEDPRFRPDMLKIYPTLVTRDAPLYAWYK
AGLYKPYTTEEAVELLVEAYKIFPKWVRVMRIQRDIPSHLIVAGVKHSNLGQLVFEELVR
RGIRPREIRFREVGHQMQKFGKMPEIEHIKLLREDYEAGEGTEIFLSFEDVKNDILIGFL
RLRIPSEKAHRKEINCCPSAIVRELHVYGPMVPIGEKPKYEWQHRGYGRELLAEAERIAR
EEFDAKKMLIISGVGVREYYRKFGYRKDGPYVSKRLDKRYADYKRTNRFDAELNT
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgaagaaatgagcgatgaagctttcaaggctgcaatagaagaaattgtaaacgca
ctcctgtctggagagataaagagtagggaagagttagagaggattaaggtagaggtggct
aaaaagtaccaccttccaaagtttccaaagaactccgacatatggaaagcccttcccaaa
gatgcaagagagaagtttagagaccttctaaaaaagaaacctacaagaacgataagtgga
gtagcagtagttgcaatgatgacgaaacccttcccatgcccccatgggagatgtatttac
tgcccaggtggaccagcagttggttcacctcaaagttacactggaaaagaaccctcagct
ttgagagcctctcaatacgcttatcatccttacataataatgatggccaggctaaagcaa
ctctacgatattggccacccaatagataaagtcgaagttataatacaaggcgggacattc
cctgcaactgatctagactaccaagaatggtacatcaagtgtgcctttaaagccatgaat
gatttctggtactttaaggacatagaaaacttggaggaaaagctagttcgcctaattctg
ctaaaagatgagtcggttcttaatgaagatccaaagtttaggaaagcctgggaaaaaacc
cacaagaaaaagttctattatttagaggaggagcagaaaaagaacgaaaaagcaaaagtt
agaatggttggtttaacaattgagacgaggcccgattgggcatttgagagacaaattgat
aggatgttagcttttgggacaactagagtcgagcttggagtacaaacaattttcaacttc
attcatgaaagggtaggaagagggcacggagttgaagaaataattaaggctactcaactc
ctgagggatgctgggttaaagataaattatcacataatgcccggactccctgggagcaac
tttgaaagggacctttacgtttttaagacgatatttgaagatccgagatttagacccgac
atgttaaagatatatccaaccctcgtaactagagatgctcccctctacgcatggtataag
gctggtctgtataagccttacactacagaagaggccgtggagttacttgttgaggcgtat
aagatattccccaagtgggttagggtcatgagaatacagagggacatcccctcccactta
attgttgcgggtgttaagcactcaaatctaggacaacttgtatttgaggaacttgtaagg
aggggaataagacccagggagataaggtttagagaggtaggccatcaaatgcagaagttt
ggaaagatgcccgaaatagaacacattaaattgcttagagaggattatgaagctggggag
ggaacagagatattcctaagctttgaagatgtgaagaatgacatactcataggtttccta
aggctgagaattccgagcgaaaaagcccacagaaaggagataaactgctgtccctcagcc
atagttagggagcttcacgtctacggacccatggttccaataggggaaaagccgaagtac
gaatggcagcatagagggtatggaagagaactcctagctgaagctgaaaggatagcaaga
gaggagtttgatgcaaagaaaatgcttattattagtggagttggagttagagagtactac
agaaaattcggctatagaaaagatggaccatatgtaagcaagagactcgacaagaggtat
gcagattacaagaggacaaataggtttgacgccgagctaaatacttga

DBGET integrated database retrieval system