KEGG   Pyrococcus furiosus COM1: PFC_10075Help
Entry
PFC_10075         CDS       T02183                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PFC_10075
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFC_10075
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PFC_10075
Enzymes [BR:pfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PFC_10075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1819386..1820552
Genome map
AA seq 388 aa AA seqDB search
MWFGEFGGQYVPETLIEPLKELEKAYKRFKDDEEFNRQLNYYLKTWAGRPTPLYYAKRLT
EKIGGAKIYLKREDLVHGGAHKTNNAIGQALLAKFMGKTRLIAETGAGQHGVATAMAGAL
LGMKVDIYMGAEDVERQKMNVFRMKLLGANVIPVNSGSRTLKDAINEALRDWVATFEYTH
YLIGSVVGPHPYPTIVRDFQSVIGREAKAQILEAEGQLPDVIVACVGGGSNAMGIFYPFV
NDKKVKLVGVEAGGKGLESGKHSASLNAGQVGVFHGMLSYFLQDEEGQIKPTHSIAPGLD
YPGVGPEHAYLKKIQRAEYVTVTDEEALKAFHELSRTEGIIPALESAHAVAYAMKLAKEM
SRDEIIIVNLSGRGDKDLDIVLKVSGNV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtggtttggtgagtttggaggtcaatatgtgcctgagactctaatagaaccattaaaa
gaattagaaaaggcatataaaaggtttaaagacgatgaggagtttaacaggcagttgaat
tattatcttaaaacctgggctggcagaccaactcctctatattatgccaaaagactaact
gaaaagataggtggggcaaaaatatatctaaagagagaagatctagttcacggaggagcc
cacaagacgaacaatgcaatagggcaagctttgttagcgaagtttatgggtaaaactagg
ctaatagctgagaccggagctggtcagcatggtgttgcaacggcaatggctggagcttta
cttggcatgaaggttgatatatacatgggagctgaggacgttgaaagacaaaaaatgaat
gtattcagaatgaaactattgggggcaaatgttattccagtaaattctggttctaggaca
ttaaaggatgcaataaatgaagccctaagggattgggtggccacgtttgaatacactcac
tacttaataggttccgtggttgggccccatccatatccaacaatagttagagactttcag
tccgtaataggaagggaagctaaggcccaaattcttgaggctgaagggcagttgcctgat
gtaatagtggcctgtgttggaggaggaagcaatgcaatggggatattttacccgtttgta
aatgataagaaggttaaacttgtgggagttgaggctgggggtaagggtttggaaagtggg
aaacactcggcatctctgaatgctggtcaagttggagtattccatggaatgcttagctac
ttcttacaggatgaggagggacagataaagcctacacacagcattgctcctggcctcgat
tacccaggagtggggcctgaacatgcatatcttaagaaaatccaaagggctgaatacgtt
actgtaactgacgaagaggcgttgaaagcgtttcacgaactttcaagaactgaaggtata
attcctgctcttgaatcagcacatgcagtagcttatgctatgaagcttgcaaaagaaatg
agtagagacgagataattatagtaaacctatctggaaggggagacaaggatcttgatata
gtcttgaaggtgagtggaaatgtttaa

DBGET integrated database retrieval system