KEGG   Pyrococcus furiosus COM1: PFC_10080Help
Entry
PFC_10080         CDS       T02183                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PFC_10080 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFC_10080 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PFC_10080 (trpA)
Enzymes [BR:pfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PFC_10080 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1820545..1821291
Genome map
AA seq 248 aa AA seqDB search
MFKDGSLIPYLTAGDPDKQSTLNFLLALDEYAGAIELGIPFSDPIADGKTIQESHYRALK
NGFKLREAFWIVKEFRRHSSTPIVLMTYYNPIYRAGVRNFLAEAKASGVDGILVVDLPVF
HAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDMTTGFVYLVSLYGTTGAREEIPKTAY
DLLRRAKRICRNKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGREATEFLKK
KVEELLGI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaggatggttctctaattccatatttaacagcgggggaccctgataagcagtct
actctcaattttctcctagctcttgatgagtatgctggggcaatagagctgggaattcca
tttagtgatccaatagctgatggtaagacaattcaagagtcgcactacagggcactaaaa
aatggatttaagttgagagaggccttctggattgttaaggaattcagaaggcattccagt
acaccaatagtcctgatgacttactacaatccaatatacagagcaggggttaggaatttt
ctagcagaggcaaaggctagtggtgtcgatggaattctagttgtggaccttccagttttt
catgctaaagagtttacagagattgctagagaagaaggcattaagacagtatttttggcg
gctcccaatactccagatgaaaggctcaaggttattgatgacatgacgactgggtttgtc
tatctagtctccctatatggaacaacaggagctagggaggaaatacccaaaactgcttat
gatttgctcagaagagctaaaaggatatgcagaaacaaggttgctgtgggattcggggtg
tctaaaagggagcacgttgtgagtttacttaaagaaggtgcgaatggagttgttgtggga
agcgctttggtaaaaataataggagaaaagggaagagaggccacagaattcttaaagaag
aaagtagaggaacttttagggatctaa

DBGET integrated database retrieval system