KEGG   Pyrococcus furiosus COM1: PFC_10310Help
Entry
PFC_10310         CDS       T02183                                 

Gene name
hisD
Definition
(GenBank) bifunctional histidinal dehydrogenase/histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00340  Histidine metabolism
pfi01100  Metabolic pathways
pfi01110  Biosynthesis of secondary metabolites
pfi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    PFC_10310 (hisD)
Enzymes [BR:pfi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PFC_10310 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFN04981
UniProt: I6USH3
Position
complement(1859394..1860521)
Genome map
AA seq 375 aa AA seqDB search
MDIEEYVREILKDIRERGLEAIREYSKKFDGYEGPFEVSKEEFKEAEERIPERDKEIIKR
TLKRIEKYHRKQLKQDILYIENGSLYGLIYKPLKRIGIYVPGGKPLPSTLMMVGVPARVA
GVKEIVVTNPPKDGKVNPYILYIAKLLKIEEVYKLGGIQAIAAMAYGIGMKKVQKIFGPG
NKFVNEAKRQVFGIVGIDSLAGPSEIAVIADESADKDFVLYDLLSQLEHGKDSKAWLLTT
SKELADYCNREGITVIVCSSLEECCKKANEIAPEHLEIITREPLKLVDLIENAGAIYLGL
YTPVPAADYFLGVNHVLPTGGAAKFMGVLTVWDFMKPISIAMVSREEFISERELGIRLAE
IEGIELHKKSLEVRK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaagaatacgtcagggagattttgaaagatatccgggaaagaggattagag
gcaataagagagtactcaaaaaaattcgacggatatgaaggcccatttgaagtctcaaag
gaggagtttaaggaagctgaagaaagaattccagaaagggataaagaaattataaagaga
actctcaagagaattgagaaataccatagaaaacaactaaagcaggacattttatacatc
gagaatggctctctctatgggctaatatacaagccactcaagagaatagggatatatgtc
ccaggtgggaaaccgctgccttcaactctaatgatggtaggagtccccgcaagggtcgct
ggagttaaggaaatcgttgtaacaaacccacccaaagatgggaaagtaaatccatacatc
ctgtacatagcaaaactcctcaagattgaagaagtatacaagctcggaggaattcaggca
atagctgccatggcttatggtattggaatgaaaaaggtccaaaagatctttgggcctggg
aataagtttgtcaatgaagcaaagagacaagtttttggaattgtcgggatagacagtttg
gctggcccttctgaaatagcagtaattgcagatgaaagtgcggataaagatttcgttctt
tacgatttgttaagccaattagaacacggaaaagatagcaaggcatggttattgacgacg
tcaaaagaactagcagattactgtaatagagagggaataacagttatcgtgtgtagctct
cttgaggaatgctgtaagaaagctaatgaaatagctccagaacaccttgagataataact
agagaacccctaaaattggtagacttaattgaaaatgcaggtgcgatatacctagggcta
tacacaccagttcctgcagctgactacttcttaggagttaatcacgttctcccaacggga
ggtgcggcaaaattcatgggtgttctcacagtttgggacttcatgaagccaataagcatt
gcaatggttagtagagaggagtttatctctgaaagagagctgggaataagattagctgaa
atagaaggaatagaactccacaaaaagagcttggaggttagaaaatga

DBGET integrated database retrieval system