KEGG   Pyrococcus furiosus COM1: PFC_10410Help
Entry
PFC_10410         CDS       T02183                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PFC_10410
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFC_10410
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PFC_10410
Enzymes [BR:pfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PFC_10410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1873842..1874879
Genome map
AA seq 345 aa AA seqDB search
MLRCTKCNRVYEEDLRIQCECEGTLLVERKYSSFAPQRRYFDMRRYLPYLPVNERFLPYL
HPPVTPVSKVKNVIFKLEYLHPTGSFKDRGTYVTVAKLKELKIKEIVIDSSGNAAISMAV
YSAFSNIRTHIFVSSNTRKEKLSLLSSFGAELHIVEGDRMKVHEEAVKYSRENNIPYLSH
WLNPYFLEGTKTVAYEIYEQVGVPEYVVVPTGSGTLFIGIWKGFKELFEMGEISRLPKMI
AVQAKGFESLCKRSNSEANVLADGIAIPNPPRKEEMFRIIKESNGSCISIGERVTRQALT
ELYRMGFIVEPTSAVAYAALKFFEDEGKSFVVPLTGSGLKLHSSF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttgttgagatgtacaaaatgcaatagagtttatgaagaagatttgagaattcagtgcgag
tgtgaaggaactctgttggttgaaagaaagtattcatcctttgctccacagagaagatat
tttgacatgagaagatatttgccctatctgcctgtcaatgagagatttctcccctatctc
catcctcctgtaacacctgttagtaaagttaaaaatgtcatatttaagttggagtatctt
catcccacggggtcttttaaggacagaggaacttatgtaactgttgcaaaacttaaagag
ttaaaaattaaggagattgtgatagatagttctgggaatgctgctattagcatggcagta
tactcagcgttctccaacattagaactcacatttttgtctcatctaatactagaaaggaa
aaactctctttgttatcttcatttggagcagagcttcatatagttgaaggagatagaatg
aaagttcatgaagaagccgttaagtactcaagggaaaacaacattccttatctctcccac
tggttgaatccatattttctcgaggggacaaaaacagtggcatatgaaatctatgagcag
gtgggagtgcctgaatatgttgtagttccaacaggaagtggaacgctcttcataggaata
tggaagggatttaaggagttgtttgaaatgggggagatatctaggctccccaaaatgata
gctgttcaagctaaaggatttgaaagtttgtgtaaaaggagtaatagtgaggcaaacgtc
ttggctgatggaatagctatacctaatccacccaggaaagaggagatgtttcggattatt
aaagagtcaaatgggtcgtgcataagtattggggaaagggtgactaggcaagctcttact
gagctctatagaatgggatttatcgttgaacctacgtcagcggtagcatacgcggccctt
aaattttttgaagatgagggaaaatccttcgtagtcccacttaccggaagtggtcttaaa
cttcacagttccttctga

DBGET integrated database retrieval system