KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_150372Help
Entry
MYCFIDRAFT_150372 CDS       T03109                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pfj  Pseudocercospora fijiensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYCFIDRAFT_150372
Enzymes [BR:pfj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MYCFIDRAFT_150372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 623 aa AA seqDB search
MKLSILSVLGCSLLAEASWRRNINYGSPSHNHPGLGLSLHKINKRNTPEKAFTADQLNFT
HGVASGDPYPDSVILWTRVAPMNADVASNKTVSAYMPLYNHGPNQTVSTAPVCVEFKVAK
DSDFAHVESSGRAYTSSDIDYTVKVEASNLTAWTRYYYQFNICGSDKKSPLGRTKTTPDE
NDYVSKVGLAVYSCSNFPFGFFNAYGNPARKDSVDFVLHLGDYIYEYAGNGDYGYGYSIG
RIPVPDKIIYTLDDYRQRLATYRTDLDLLLSHQSFPWIPVWDDHDVSDNTYRDGASELNN
TEASFVMDGGVSVDQRKMNAVRAYFEWMPIRQVEMDDNLRIWRSFKIGSLLDLVMLDTRQ
YDRSITDLYWNTDYIHSISNDAGRSMMGSRQENWFYNQLGESANRGARWRVIGSQTVFSR
VNESVSFGNTNPLDYDAWDGYQANRNRTLNFLTQNKIGNNIVISGDSHASWVSDLVWLDH
TDYSPSNGNGGLGVEFAGSAVTSPCPYGQNITIKSANNYSDWLVGANPELQWNDLYYRGY
FELHLTYEEVNASYFGLPTVHTRNPLEISIANFTVKSGANKLQRPFGVVESGSLKGGKIL
QTNLTNNTANGVWAVVNAAREEI
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctccatcctgtccgtccttggctgttctctgcttgcagaagcgagctggagg
aggaacatcaactatggatccccatctcacaaccatccaggccttggcctgtcactgcac
aaaatcaacaagagaaatacgcccgagaaggcattcactgcggatcaactcaacttcacc
catggcgtggcttctggtgatccataccccgatagcgtcatactatggactcgcgtagcg
ccgatgaacgcggacgtggctagcaacaagacagtgagcgcatacatgcctctatacaac
cacggccccaatcagacagtgtcgaccgctccagtctgtgtcgaattcaaggtggccaag
gattcggactttgcgcacgtggaaagcagtggaagagcgtacacctcaagtgatattgat
tacactgtcaaggttgaggcttcaaacctgacggcatggacacgctactactaccagttc
aatatctgtggtagcgataagaagagtcctcttggtcgcaccaagaccacgcctgacgag
aacgactacgtctcgaaggtcggccttgctgtgtactcttgcagcaactttccatttggt
ttcttcaacgcctatggaaatcccgccagaaaggacagcgtcgatttcgtccttcacctt
ggtgactacatttacgagtacgcaggcaatggcgattatgggtatgggtacagcattggc
cgtattccagttcccgacaagatcatctacaccctcgatgactaccgacagagacttgcc
acttaccgcaccgacttggatcttttactctcgcaccagtctttcccttggattccggtg
tgggacgaccacgatgtctctgacaacacgtaccgcgacggcgcttcggagctgaacaat
accgaggcttctttcgttatggacggaggagtttctgtcgatcagcgcaagatgaatgca
gtacgcgcatatttcgaatggatgccaattcgtcaggttgagatggacgacaatctccgc
atctggcgtagtttcaagatcggctcccttctcgatctggttatgctcgacactcgtcag
tacgaccgctcgatcactgatctgtactggaacaccgactatatccattccatctctaac
gatgccgggcgatcgatgatgggaagtcgacaagagaactggttctacaaccaactcggt
gaatctgctaaccgtggtgcgagatggcgagtcataggttctcagaccgtgttctcgaga
gtgaacgagtctgtttcgttcggaaacaccaaccccttggactacgatgcatgggatgga
taccaagcgaaccgcaaccgcacattgaacttcctcactcagaacaaaatcggaaacaac
atcgtgatctcaggagacagtcatgcttcttgggtgtctgatctggtctggcttgatcac
actgactactctccttcaaatggcaacggcggtctgggcgttgagttcgccggctctgcg
gtcacctcgccctgtccatatggccagaacatcactatcaagagcgcgaacaattacagc
gactggctggtcggcgccaacccagaactgcagtggaacgatctttactacagaggatac
tttgaactccacctcacctacgaggaggtcaacgcttcgtactttggcctgccaactgtt
catactcgcaaccccctcgagatttccattgcaaacttcaccgtgaagagcggcgctaat
aagttgcagagaccttttggggtcgtagagagtgggagtttgaagggtgggaagattctt
cagactaatcttactaataatactgcaaatggtgtctgggctgtggtcaatgccgcaagg
gaggagatttag

DBGET integrated database retrieval system