KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_205450Help
Entry
MYCFIDRAFT_205450 CDS       T03109                                 

Definition
glycoside hydrolase family 13 protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pfj  Pseudocercospora fijiensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCFIDRAFT_205450
Enzymes [BR:pfj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MYCFIDRAFT_205450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 502 aa AA seqDB search
MPENATLLQGFEWNVPADGKHWQRLLKALPSLKNAGIDNLWLPPGCKASSPEGNGYDIYD
LYDLGEFDQKNSVRTKWGTKDELLELSNKAKELGIGLYWDAVLNHKAGADKREKAHAVEV
DNDDRTKEVTDPYQISAWLGFDFPGRGDKYSKQKYHWYHFSGTDYDAKNERNAIFKLKGE
GKSWSESVDDEGGNADYMMFADVDYSHPETQEDVKNWGEWIVNEVGLKGFRLDAVQHFSE
RFANDWVQHVRSKCGDAIFMVGEFWTGDTENMLKWLDAMDRKFSLFDAPLLYNFNRLSTT
PDADLRTVFDNSLTKRDPVNSVTVVMNHDTQPGQTMDTKIEGFFKPLAYALILLQDAGYP
CLFYGDLYGMKGDSPEPPAASGKIPDMALARKLYAYGRQDEYLDDPNCIGFTRLGTAEHP
AGLACVMSNKGPGSLRMFVGEMHRGEVWTDVLGWEQGEVTIGEDGLGDFRCPGVSVAIWV
KRDAEGRDRFPVEFDNDIYNEA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagaacgccactctccttcaaggctttgagtggaacgtgccggccgatggcaag
cactggcaacgtcttcttaaagcattgcctagtctgaagaatgccggcatcgataatctg
tggctgcctccaggttgtaaggcatcatctcccgagggcaacgggtacgatatctatgat
ttgtatgaccttggcgaattcgaccagaagaactcagtgcggaccaaatgggggaccaaa
gatgagcttcttgaactcagcaacaaagccaaagaactagggattggtctttactgggac
gcagtgctcaaccataaggccggcgccgacaaaagagaaaaggcgcatgccgtggaggta
gataatgacgacaggacgaaagaagtcacagacccataccagatcagcgcttggctcggc
ttcgattttcctggccgaggggacaaatactcgaagcagaagtaccactggtaccacttt
tccggcaccgactacgatgctaagaacgagaggaatgccatcttcaagctcaaaggggag
ggcaagtcttggagcgagagtgtcgatgatgaagggggcaatgccgactacatgatgttc
gccgatgtcgattactcacatccggaaacgcaagaggatgtgaagaactggggtgaatgg
atcgtcaacgaagtcggtctgaaggggttcaggttagacgcagtgcaacacttctcggaa
cgattcgcaaacgactgggtgcagcacgtacgatcgaaatgcggagacgccatcttcatg
gtgggagaattctggaccggagacacagaaaacatgttaaagtggttggatgccatggat
cgaaagttcagcttattcgatgcgccgctcctctacaacttcaatcggctaagcacaaca
cctgacgccgatctcaggaccgtcttcgacaattctctgaccaagcgagatccagtaaac
tccgtcacagtggtcatgaatcacgacacgcaaccaggccagactatggacaccaagatt
gaaggtttcttcaagcctctagcatacgcattgattctccttcaagatgccggatatcct
tgtcttttctatggcgacctgtacggcatgaagggtgatagtccggagcctccagctgca
tctggaaagattccggacatggcgctcgcccgcaagctctacgcctacggtcgtcaagat
gagtatctagatgatcccaattgcattggtttcacccgactcggcactgcagaacatcca
gctggcttggcatgcgtgatgagcaataaaggccctggaagtcttcggatgttcgttgga
gagatgcatcgaggtgaagtgtggactgatgttctcggctgggaacagggcgaggttacc
attggcgaagacggcctcggcgacttcaggtgccccggcgtcagcgttgccatctgggtg
aagagagatgccgaagggcgggatcgcttcccggtcgaattcgacaatgacatatacaac
gaggcataa

DBGET integrated database retrieval system