KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_210486Help
Entry
MYCFIDRAFT_210486 CDS       T03109                                 

Definition
glycoside hydrolase family 30 protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
pfj  Pseudocercospora fijiensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfj00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MYCFIDRAFT_210486
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MYCFIDRAFT_210486
Enzymes [BR:pfj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     MYCFIDRAFT_210486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 488 aa AA seqDB search
MLSFAIVSFIASAISIAALPLEIRQSSTSAYCSDYNGTYKLSAITAPARGAGTQPSGTTA
WGLVLNDTAAAYRQNITGFGAAVTDSTVVTFNRMSSTNQNSLINTLMTTSGANFSLMRHT
IGGSDMSATNYTYDDNNNQPDPNLANFTLGTNGTAMASVLAKMRKAQPGMTLLGSSWSAP
GWMKRNKALTGNAKNNNLQDTYLNSSETDYSYAFANYFVKYIQAYQNAGAPVNAITLQNE
PLNSVAGFPTMYVYDYENALLIKNRLGPAFAQAGLTTQIWAYDHNTDKPSYPQTILDHAG
QYVNTVAWHCYSGTSGWDVLSSFKANNTNVIQYMTECWTPSTPPWYNAAAFTMGPLQNWA
SGAMAWNLAADVNNGPHIYNGCAHCTGLVTINNDGSYTLNTAYYMMAQFSKFMPGGARVL
PVAGGGSISNGQAVQSVGSINPDGTRTVVFLSTVTNSVYMTLNTTSGQTWSGTIPPQSVV
TWILPKIS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcttcgctatcgtctcattcattgccagtgccatctccatcgctgccttacca
ttagagatccggcagtcttccacatcagcttattgcagcgactacaatggcacatacaag
ctcagtgccattactgcccctgcccgtggtgccggcactcagccgtctggcacaacagct
tggggtttggtgctcaacgacactgcagctgcgtaccgacagaacattaccggcttcggc
gcggcggtgaccgactccaccgtcgtcacctttaatcgaatgtcaagcaccaatcagaac
agtctgatcaatacgttgatgacaacatctggagcgaacttctccctcatgcggcacacg
atcggtggctccgacatgagtgccaccaactacacgtatgacgacaacaataatcagcct
gatcctaatctggccaatttcacgctcggtacgaatggcacagccatggcctccgtactt
gccaagatgcggaaagctcagcctggaatgacactccttggttcttcctggagcgcacct
gggtggatgaagagaaacaaagctctcacaggcaacgccaaaaacaacaatctacaagat
acatatctcaactctagcgagaccgactactcttatgccttcgccaactactttgtcaag
tacattcaagcctaccagaatgctggagcaccagtcaatgccatcactttacaaaacgaa
cccctgaactctgttgctggcttcccgactatgtacgtatatgactacgagaacgctctc
ttgatcaagaaccgtctcgggccagccttcgctcaagcaggcttgactactcagatttgg
gcctacgatcacaacacagacaagccatcctatcctcaaacaatccttgaccatgcaggc
caatacgtcaacacggtagcttggcactgctactccggcacctcaggatgggacgtcctc
tcctctttcaaagcaaacaacaccaacgtgatccaatacatgaccgaatgttggactcct
tccacacctccctggtacaacgccgcagcattcaccatgggccctctacaaaactgggct
tcgggagcgatggcttggaacctcgctgccgatgtgaacaacggtcctcacatctacaat
ggctgcgcacactgtaccggtctcgtcaccatcaataacgatggatcttatacactgaat
actgcttactacatgatggcgcagttcagtaagttcatgcctggaggtgcacgagtcctg
cctgtcgctggtggtgggagcatttcaaatggacaggctgtccagagtgtcggatccatc
aatcctgatggcacgcgaactgtcgtctttctcagcactgttacaaacagtgtttatatg
acactcaacactaccagcggtcagacttggagtggaaccatcccgccgcagagtgtggtg
acttggattttgcccaagatttcttaa

DBGET integrated database retrieval system