KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_31653Help
Entry
MYCFIDRAFT_31653  CDS       T03109                                 

Definition
(RefSeq) glycoside hydrolase family 32 protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
pfj  Pseudocercospora fijiensis
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MYCFIDRAFT_31653
   00500 Starch and sucrose metabolism
    MYCFIDRAFT_31653
Enzymes [BR:pfj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MYCFIDRAFT_31653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 599 aa AA seqDB search
PLRQLKQLPELTREQRFARWRPSYHLMAREGWMNDPCAPGYDPNTGLYHVSFQWNPYGPD
WGDICWGSATSPDMINWTLQDEPCLRPEASYDNKGIFTGCMINGKDGALTYAYTSVNHLP
IHYTLPHVIGSESLSLAKSFDGGKIFRRIDANPILPSEPAGLDVTGWRDPFVAKWPRMAR
HLSLDEDNTLFGIVSGGIRDTTPTTFLYAIDANELSKWRYIGPLANFGDNLRPSKWSGDF
GKNWEVTNFTTLRDSEDPSIERDFVIMGIEGCIPERRPSAPGPDTLSPSRPSTKAQLWFS
GDLQTPKSSPSAGPVEMTFKFGGHYDNGCLYAANSFFDPKTQKQIAWGWIREEDICDDLR
HGQGWSGCLSMPRELSLQTLHNVVGTSSGSDLSSITSIERKLNADGTYTIRTLASQPYAP
LVSALRRNPGVKYTYLPRSDLGSFTSVHLPGGLTSKAWELDATFSSSRSTQHIGISISHA
EDNSRTTTLFYDQPSESFVINRPAFPVLNSSELVNSEPERAPFTLFETKEAGREELRVRI
WRDNSVMEVFVNGRCAITTRIYAAEETFGVKFFADEMVDGILDVPSQLLKAEVWDGIGI
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
ccacttcggcaattgaagcagctaccggaactcaccagagaacagcgctttgcgagatgg
cgaccttcgtaccatttgatggccagggaaggctggatgaacgacccgtgtgcgcccgga
tatgatccaaacactggtctttatcatgtatccttccagtggaatccctacggccctgat
tggggagatatatgttgggggtcggcaacgtcgcccgatatgatcaactggacattgcaa
gacgaaccgtgcctcagaccggaggccagctatgacaacaaaggcattttcacaggctgc
atgatcaacggaaaagacggcgcgcttacttacgcatatacatcggtcaatcacctaccc
atacattacaccttaccacatgtaataggaagtgagtcgttaagtctggcaaagtctttc
gatggcggcaaaatctttcgacgcattgatgccaatcctattctgccatcagaacctgct
ggtctcgatgtgactggttggcgggatcctttcgttgccaaatggcctcgcatggccaga
catctcagccttgacgaagacaataccctattcggaattgtatctggtggcattcgagac
acgaccccaactacattcttgtacgcgatagatgccaacgagctctccaaatggaggtac
attggaccactagcaaacttcggtgacaatttacgaccatccaaatggtcgggcgacttc
ggcaagaattgggaagtcaccaacttcacgactctccgcgactcagaagatccaagtatc
gaacgcgacttcgtcataatgggcatagaaggctgcatacccgaacggagaccctctgct
cctggcccagacacccttagcccatcgcgaccttcaacaaaagctcagctctggttctca
ggcgatctccagacaccgaaaagttctccctccgcaggaccagttgagatgacattcaaa
tttggtgggcattacgacaatggttgcctctatgcggccaactcattcttcgaccccaag
acacagaagcagatcgcttggggatggatcagagaagaagatatctgcgatgacttacga
cacggacaaggctggagtggctgtctctcaatgccaagagagctttccctccaaacgctg
cacaacgtcgtcggtacatcctccggatctgacctgtcgtcaataacatctatcgaaagg
aagctcaacgccgacggcacatacacgatccgcactctggcctcccagccttatgctcct
ctcgtctccgcccttcgacgaaacccgggcgtgaagtatacctacctcccacgctctgac
ctcggctcattcacctccgtccaccttcctggcggcctgacctccaaagcatgggaactc
gacgccacattctcctcctctcgctccacccaacacatcggcatctccatctcccatgcc
gaagacaactcccgcaccacaaccctcttctacgaccaaccttccgagtcattcgtcatc
aatcgtcccgctttcccagtcctcaattcaagcgaactcgtcaactctgaacccgagaga
gctcctttcacacttttcgaaacgaaggaagcaggaagggaggagttgagggttagaata
tggagggataacagtgtaatggaagtctttgtgaatggtcggtgtgcgattactacgagg
atttatgccgcggaggagacgtttggggttaagttctttgcggatgagatggttgatggg
attttggatgttccgagtcagttgcttaaggcggaggtttgggatgggattggaatttaa

DBGET integrated database retrieval system