KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_87623Help
Entry
MYCFIDRAFT_87623  CDS       T03109                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pfj  Pseudocercospora fijiensis
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:pfj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MYCFIDRAFT_87623
Enzymes [BR:pfj01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     MYCFIDRAFT_87623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 339 aa AA seqDB search
MFSTRLFRPAQQLSSHVRRYASEAPKSGGGNGLLIGGIAAAALGGGYYFMSGTKDPVAKA
EELTAAAYENKPPSMGGPPDKVFIGGDQGFVKLKLDKSESVSHNTKRLRFAFENPDAVSG
LPVASALITKFKGPEDEKPTIRPYTPVSDEEERGFLDLLVKQYKGGPMSTHLHEMETGQT
LEFKGPIPKYPWEANKHNHIALLAGGTGITPMYQLCRQIFKNPADKTKVTLVFGNVTEED
ILLKKEFQDLEQQFPQRFRAFYVLDNPPKGWKQGKGHITKDLLKTVMPAPDEENIKVFVC
GPPGLYKAISGAKKSPADQGELSGILKELGYEKDQVFKF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttctccacacgcctctttcgacctgcacagcagctctcgagtcacgttcgaagatac
gcttccgaagcaccaaagtctgggggcggcaatggactcctcatcggaggcattgctgcg
gcagcactaggcggtggctactacttcatgtcaggcacaaaagacccagtcgcaaaggca
gaggagctcacggcagctgcatacgagaacaagcctccatcgatgggaggtccgccagac
aaggtcttcatcggcggcgaccagggcttcgtcaagttgaagttggacaagtctgagtcc
gtgagccacaacaccaagaggctgcgattcgcattcgagaacccagatgcagtcagcgga
cttcccgtagccagcgcactcattacaaaattcaagggcccagaggatgagaagccaaca
atcagaccatatacaccagtcagcgacgaggaagagcgaggttttttggatctgctcgtg
aagcagtacaagggaggtccaatgtccacacacttgcacgagatggagacaggtcaaaca
ctcgagttcaagggacctattcccaaatatccctgggaagccaacaagcacaaccacatc
gcgcttctcgctggtggaaccggtatcactccaatgtatcaactctgccgacaaatcttc
aagaacccagcggacaagacaaaggtaacgctagtctttggcaacgtcactgaggaggac
attttgctcaagaaggaatttcaagatctggaacagcagtttccacagcgattccgtgca
ttctacgtccttgacaacccaccgaagggttggaagcagggaaagggccacatcaccaag
gatctgctcaagaccgtgatgccagctcctgacgaggagaacatcaaggtgtttgtttgc
ggaccacctggtctatacaaggccatctcgggcgcgaagaagagcccggctgaccagggc
gagctgagcggcatcctgaaagaacttggttacgagaaggaccaggtgttcaagttttaa

DBGET integrated database retrieval system