KEGG   Pseudomonas protegens Pf-5: PFL_0087Help
Entry
PFL_0087          CDS       T00249                                 

Definition
(GenBank) diguanylate cyclase (GGDEF) domain protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
pfl  Pseudomonas protegens Pf-5
Brite
Enzymes [BR:pfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     PFL_0087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
85474..87657
Genome map
AA seq 727 aa AA seqDB search
MSDDANRWKEKYLKSIEQQEKLERRWAARLDLLRRGLVRSTLAAEGTDRAVDQCMKEMRE
VVRTDDMDAGLAALLPRLEKAVLDSEQRRETRVEQMSSALTALVSQLQSLPLPREVSRPL
KAFAKQLDGRVGQAREIPLLLGELSSLQGKALSQLETPAEPDRPSLLQRLFGSREASETP
APAEEAVATNPPLPAAAAEAHPQAEEAPAPEDGAREHYQTPTQALPEAVSAPAAPAPAQP
EVQLEPEPGAQPVASDEPEVAAVPAPAPVVAFVPPVLVQEAPAEPVPAIEVEPQATISPV
AEPQAPVDPGVVAASDSPPAPVAEAALNPDELVPLPTVSPAVLLDSLPLPAVMAEALAAI
DPEQSEHDVLYALPDSPEPSYSSVAKHIEHTLLGLLDDLSLPERHRPQAEAMRDRLQHGL
NWYELLPILDDLAVLMLAITDSGQHEFETYLKQLNERLEAFQSNLQAASDGHADSSSAAR
AMDSQIREQVDGLQSSVQEAADLDDLKQVLESHLEGLLGTMDHHQKQRDEREREVAARLQ
SLAERVSSMEQEAQGYREHLEEQRQKALIDPLTGLPNRAAWSERLEHEVGQWQQHGNSLL
LAMLDLDHFKRINDNYGHLAGDKVLKIIANVLRKRLRGSDFIARFGGEEFVLLLPNTPWP
VGVRIVEALRAAIEACPFHFKGEPVTITVSVGLSAFKAGDRSDLVIKRADQALYRAKDAG
RNRVEAG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacgccaatcgctggaaagagaaatacctcaaaagtatcgaacagcaggaa
aagctcgaacgccgatgggcggcccgtctcgacttgctgcgtcgtggcctggtacgcagc
accctggcggcggagggcaccgatcgcgcggtcgaccagtgcatgaaggaaatgcgcgag
gtggtacgcaccgacgacatggacgccgggcttgcagccctgctgccgcgcctggaaaaa
gccgtgctggactccgagcagcggcgggaaacccgggtcgagcagatgagcagcgcgctg
acggcgctggtcagccagttgcagtccctgcccctgccccgggaggtcagccgtccgctg
aaagcctttgccaagcaactggatggccgggttggccaggcgcgggaaattcccttgctg
ctcggcgaactgagcagcctgcagggcaaggccctgagccagctggaaaccccggccgaa
cccgaccgcccaagcctgttgcagcgcctgttcggcagccgcgaggcgagcgagacgccg
gccccggcggaggaagccgttgcgacgaatccgccgctcccggccgccgcggcggaggct
catccgcaagccgaggaagccccggccccggaggatggcgcgcgcgagcactatcagacg
ccgacccaggccttgcctgaggcggtttcggcgcctgccgcgcccgctccggcacagccc
gaagtgcagctcgaacctgagccgggtgcccagccggttgccagcgacgagccggaggtt
gctgcagtgcccgctccggccccggtggtggcgttcgtgcctccggtactggtgcaggag
gcgcccgccgagcctgtacccgctatcgaggtcgaacctcaagcaaccatttcgcctgtc
gcggagccacaagcgcccgtcgatcccggggtggtcgccgcttccgattcgccgccagcg
cctgtcgccgaagccgcgctcaatcccgacgagttggtgcccctgccgacggtttccccg
gcagtgctgctggacagcctgcccctgccggcagtcatggccgaggccctggccgccatc
gatccggagcagtcggagcacgatgtgctctacgctctgccggattcgcccgagccctcc
tacagttcggtggccaagcacatcgagcacaccttgctggggctgctcgacgacctgagc
ctgccggagcgccaccggccacaggccgaggccatgcgcgatcgtctgcagcatgggctg
aactggtacgaattgctgccgatcctcgacgatctggcggtgttgatgctggccatcacc
gactctggccagcatgagttcgagacctacctcaagcagctcaacgagcgcctggaggcc
ttccagagcaacctgcaggcggccagcgacggccatgccgacagcagttcggcagcacgg
gccatggacagccagatccgtgaacaggtcgacggcctgcaaagcagcgtgcaggaggcc
gccgacctggatgacctcaagcaagtgctggaaagccacctggaaggcctgctgggcacc
atggaccaccaccagaagcagcgcgacgagcgtgaacgggaagtggccgcccgcctgcaa
agcctggcggagcgggtttcgagcatggagcaggaagcccagggctaccgtgagcacctg
gaagagcagcggcagaaggcgctgatcgatccgctcaccggcctgcccaaccgggctgcc
tggagcgaacgcctggaacatgaagtcggccaatggcaacaacatggcaacagcctgctg
ctggccatgctcgatctcgatcatttcaagcggatcaacgacaactacggtcacctggcc
ggtgacaaggtgttgaagatcatcgccaacgtactgcgcaaacgcctgcgaggcagcgat
ttcatcgcacgtttcggtggcgaggagtttgttctgctgctgcccaacaccccctggccg
gtgggcgtgcgcattgtggaagccctgcgcgcggcaatcgaggcgtgcccgttccatttc
aagggcgagccggtgaccatcaccgtgtccgtcgggctgagtgcgttcaaggccggtgat
cgcagcgatctggtgatcaaaagagccgatcaggcgctgtaccgggccaaggatgccggc
cgtaaccgggtggaagctggttga

DBGET integrated database retrieval system