KEGG   Pseudomonas protegens Pf-5: PFL_0087Help
Entry
PFL_0087          CDS       T00249                                 

Definition
diguanylate cyclase domain-containing protein
Orthology
K13590  
diguanylate cyclase
Organism
pfl  Pseudomonas protegens Pf-5
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
85474..87657
Genome map
AA seq 727 aa AA seqDB search
MSDDANRWKEKYLKSIEQQEKLERRWAARLDLLRRGLVRSTLAAEGTDRAVDQCMKEMRE
VVRTDDMDAGLAALLPRLEKAVLDSEQRRETRVEQMSSALTALVSQLQSLPLPREVSRPL
KAFAKQLDGRVGQAREIPLLLGELSSLQGKALSQLETPAEPDRPSLLQRLFGSREASETP
APAEEAVATNPPLPAAAAEAHPQAEEAPAPEDGAREHYQTPTQALPEAVSAPAAPAPAQP
EVQLEPEPGAQPVASDEPEVAAVPAPAPVVAFVPPVLVQEAPAEPVPAIEVEPQATISPV
AEPQAPVDPGVVAASDSPPAPVAEAALNPDELVPLPTVSPAVLLDSLPLPAVMAEALAAI
DPEQSEHDVLYALPDSPEPSYSSVAKHIEHTLLGLLDDLSLPERHRPQAEAMRDRLQHGL
NWYELLPILDDLAVLMLAITDSGQHEFETYLKQLNERLEAFQSNLQAASDGHADSSSAAR
AMDSQIREQVDGLQSSVQEAADLDDLKQVLESHLEGLLGTMDHHQKQRDEREREVAARLQ
SLAERVSSMEQEAQGYREHLEEQRQKALIDPLTGLPNRAAWSERLEHEVGQWQQHGNSLL
LAMLDLDHFKRINDNYGHLAGDKVLKIIANVLRKRLRGSDFIARFGGEEFVLLLPNTPWP
VGVRIVEALRAAIEACPFHFKGEPVTITVSVGLSAFKAGDRSDLVIKRADQALYRAKDAG
RNRVEAG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacgccaatcgctggaaagagaaatacctcaaaagtatcgaacagcaggaa
aagctcgaacgccgatgggcggcccgtctcgacttgctgcgtcgtggcctggtacgcagc
accctggcggcggagggcaccgatcgcgcggtcgaccagtgcatgaaggaaatgcgcgag
gtggtacgcaccgacgacatggacgccgggcttgcagccctgctgccgcgcctggaaaaa
gccgtgctggactccgagcagcggcgggaaacccgggtcgagcagatgagcagcgcgctg
acggcgctggtcagccagttgcagtccctgcccctgccccgggaggtcagccgtccgctg
aaagcctttgccaagcaactggatggccgggttggccaggcgcgggaaattcccttgctg
ctcggcgaactgagcagcctgcagggcaaggccctgagccagctggaaaccccggccgaa
cccgaccgcccaagcctgttgcagcgcctgttcggcagccgcgaggcgagcgagacgccg
gccccggcggaggaagccgttgcgacgaatccgccgctcccggccgccgcggcggaggct
catccgcaagccgaggaagccccggccccggaggatggcgcgcgcgagcactatcagacg
ccgacccaggccttgcctgaggcggtttcggcgcctgccgcgcccgctccggcacagccc
gaagtgcagctcgaacctgagccgggtgcccagccggttgccagcgacgagccggaggtt
gctgcagtgcccgctccggccccggtggtggcgttcgtgcctccggtactggtgcaggag
gcgcccgccgagcctgtacccgctatcgaggtcgaacctcaagcaaccatttcgcctgtc
gcggagccacaagcgcccgtcgatcccggggtggtcgccgcttccgattcgccgccagcg
cctgtcgccgaagccgcgctcaatcccgacgagttggtgcccctgccgacggtttccccg
gcagtgctgctggacagcctgcccctgccggcagtcatggccgaggccctggccgccatc
gatccggagcagtcggagcacgatgtgctctacgctctgccggattcgcccgagccctcc
tacagttcggtggccaagcacatcgagcacaccttgctggggctgctcgacgacctgagc
ctgccggagcgccaccggccacaggccgaggccatgcgcgatcgtctgcagcatgggctg
aactggtacgaattgctgccgatcctcgacgatctggcggtgttgatgctggccatcacc
gactctggccagcatgagttcgagacctacctcaagcagctcaacgagcgcctggaggcc
ttccagagcaacctgcaggcggccagcgacggccatgccgacagcagttcggcagcacgg
gccatggacagccagatccgtgaacaggtcgacggcctgcaaagcagcgtgcaggaggcc
gccgacctggatgacctcaagcaagtgctggaaagccacctggaaggcctgctgggcacc
atggaccaccaccagaagcagcgcgacgagcgtgaacgggaagtggccgcccgcctgcaa
agcctggcggagcgggtttcgagcatggagcaggaagcccagggctaccgtgagcacctg
gaagagcagcggcagaaggcgctgatcgatccgctcaccggcctgcccaaccgggctgcc
tggagcgaacgcctggaacatgaagtcggccaatggcaacaacatggcaacagcctgctg
ctggccatgctcgatctcgatcatttcaagcggatcaacgacaactacggtcacctggcc
ggtgacaaggtgttgaagatcatcgccaacgtactgcgcaaacgcctgcgaggcagcgat
ttcatcgcacgtttcggtggcgaggagtttgttctgctgctgcccaacaccccctggccg
gtgggcgtgcgcattgtggaagccctgcgcgcggcaatcgaggcgtgcccgttccatttc
aagggcgagccggtgaccatcaccgtgtccgtcgggctgagtgcgttcaaggccggtgat
cgcagcgatctggtgatcaaaagagccgatcaggcgctgtaccgggccaaggatgccggc
cgtaaccgggtggaagctggttga

DBGET integrated database retrieval system