KEGG   Pseudomonas protegens Pf-5: PFL_0249Help
Entry
PFL_0249          CDS       T00249                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pfl00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(288276..289271)
Genome map
AA seq 331 aa AA seqDB search
MIKQQLARFNRLDLLRSTTALEKLERLSAWIGRDVYVKRDDSTPLAMGGNKLRKLEYLAA
DALAQGADTLITAGAIQSNHVRQTAALAAKLGLGCVALLENPTGTQDPNYLGNGNRLLLD
LFDAKVELVENLDQADEQLHALAARLRSNGKKPYLVPIGGSNALGALGYVRAGLELAQQI
EDSGLEFAAVVLASGSAGTHSGLALALSEVLPQLPVIGVTVSRSEEDQRPKVQGLAERTA
ELLGVKLPDAFNVQLWDEYFAPRYGEPNAGTLAAVKLLASQEGLLLDPVYTGKAMAGLLD
GVGRQRFDDGPLIFLHTGGAPALFAYAGAFS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaacaacagctcgcccgctttaaccgtctcgacctgctcaggtctaccaccgcc
ctggaaaaactcgaacgcctgtcggcctggatcggtcgcgatgtctacgtcaagcgtgac
gacagcacacccctggccatgggcggcaacaagctgcgcaagctcgaatacctggccgcc
gatgccctggcccagggcgccgacaccctgatcaccgccggtgccatccagtccaaccat
gtgcgccagaccgcagccctggctgccaagttggggctgggctgcgtggccctgctggaa
aaccccaccggcacccaagaccccaactacctgggcaatggcaaccgcctgctgctggac
ctgttcgacgccaaggtggagctggtggaaaacctcgaccaggccgacgagcaactgcac
gccctggccgcgcgcctgcgcagcaacggcaagaaaccctacctggtgcccatcggcggc
tccaacgccctgggggccctgggctacgtgcgcgccggcctggagctggcgcagcagatc
gaagacagcggcctggaatttgccgccgtggtcctggcctccggcagcgccggcacccac
agcggcctggccctggccttgagcgaagtgctgccgcaactgccggtgatcggggtcacc
gtgtcgcgcagcgaagaagaccagcggcccaaggtccagggcctggccgaacgcaccgcc
gagttgctgggagtgaagctgcccgacgctttcaacgtgcagttgtgggacgagtacttc
gccccgcgctacggtgagcccaatgccgggacgctggcggcggtcaagctgctggccagc
caggaaggcctgttgctggacccggtgtacaccggcaaggccatggccggcctgctggac
ggggtcggtcgccagcgcttcgacgatggcccgctgattttcctgcacaccggcggcgcc
ccggccctgttcgcctacgccggcgccttctcgtag

DBGET integrated database retrieval system