KEGG   Pseudomonas protegens Pf-5: PFL_0318Help
Entry
PFL_0318          CDS       T00249                                 

Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PFL_0318
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PFL_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(368775..369161)
Genome map
AA seq 128 aa AA seqDB search
MKPIAVSILTLLLHSLLFSAPALAGDAEAGAKLFKRLCSGCHNIGPSVRSSFGPQLNGII
DRPAGSAADYQYSTAMKSSGIVWSRDKLIQYLEDPKAVVPGTRMIFWGLSDEEKIDNLLA
YLQTFQTP
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccatcgccgtatcgatcctaaccctgttgctccactccctgctattcagcgcc
ccggccctggccggtgatgccgaagccggcgccaagctgttcaagcgcctgtgcagcggc
tgccataacatcgggccttcggtgcgcagttccttcgggccgcagctcaatggcatcatc
gaccgccccgccggcagcgccgcggactaccagtactcgacggccatgaagtcctcgggc
attgtctggagccgggacaagctcatccagtacctggaagaccccaaggccgtggtgccc
ggtacccggatgattttctgggggctgagcgatgaggaaaaaatcgataatctgctggcc
tatctgcagacgttccagaccccctga

DBGET integrated database retrieval system