KEGG   Pseudomonas protegens Pf-5: PFL_0325Help
Entry
PFL_0325          CDS       T00249                                 

Gene name
gpuA
Definition
3-guanidinopropionase GpuA (EC:3.5.3.17)
Orthology
K18459  
guanidinopropionase [EC:3.5.3.17]
Organism
pfl  Pseudomonas protegens Pf-5
Brite
Enzymes [BR:pfl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     PFL_0325 (gpuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(374611..375567)
Genome map
AA seq 318 aa AA seqDB search
MSKPFPQPVDAALVPRFAGIPSFMRLPLFNDPAQVQIALVGVPWDGGTTNRAGARHGPRE
VRNQSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLKQIEGFFSQLHQAGAVPL
AVGGDHLVTLPIFRALARHRPIGMVHFDAHSDTNDRYFGDNLYTHGTPFRRAIEEGLLDP
KRTVQIGIRGSIYSADDEAFARDCGIRVIHMEEFADIGVEATLAEARRVVGDGPTYISFD
VDVLDPAFAPGTGTPEIGGMTTLQAQQMIRGLRGLNLVGADVVEVSPPFDVGGATALVGA
TLMFELLCILAESIAQGS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagccctttccccaacccgtggacgccgccctggtaccacgcttcgccggcatt
ccaagcttcatgcgcctgccgctgttcaacgacccggcccaggtgcagatcgccctggtg
ggcgtgccctgggacggcggcaccaccaaccgtgccggtgcccgccacggcccgcgggag
gtgcgcaaccagtcgagcctgatgcgcaaggtgcaccatgtcagccgcatcgccccctat
gacctggtccgggtcggtgacctgggtgatgcaccggtgaaccccatcgacctgctggat
tcgctgaaacagatcgaaggtttcttcagccaattgcaccaggccggcgccgtgcccctg
gcggtgggtggcgaccacctggtgaccctgccgatcttccgcgccctggcccgccaccgg
cccatcggcatggtgcacttcgatgcccactccgacaccaacgaccgctacttcggcgac
aacctctacacccacggcacgccctttcgccgcgccatcgaagaaggcctgctggacccc
aagcgcacggtgcagatcggcattcgcggttcgatctacagcgccgacgacgaggctttc
gcccgggactgcgggattcgcgtgatccacatggaagagttcgccgacatcggcgtcgaa
gccaccctggccgaagcccggcgcgtggtgggcgacggcccgacctacatcagcttcgac
gtcgacgtgctcgacccggccttcgcccccggcaccggcaccccggagatcggcggcatg
accaccctccaggcccagcagatgatccgcggcctgcgcggcctgaacctggtcggcgcc
gacgtggtggaagtctcgccgcccttcgacgtcggcggcgccaccgccctggtgggcgcg
accctgatgttcgagttgctgtgcatcctcgccgaatcgatagcgcaaggctcctga

DBGET integrated database retrieval system