KEGG   Pseudomonas protegens Pf-5: PFL_0424Help
Entry
PFL_0424          CDS       T00249                                 

Gene name
hisI1
Definition
phosphoribosyl-AMP cyclohydrolase (EC:3.5.4.19)
Orthology
K01496  
phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PFL_0424 (hisI1)
  Amino acid metabolism
   00340 Histidine metabolism
    PFL_0424 (hisI1)
Enzymes [BR:pfl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     PFL_0424 (hisI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(487854..488246)
Genome map
AA seq 130 aa AA seqDB search
MKDWLDQIKWDADGLVPAIAQDHKTGRVLMMAWMNREALSLTAAENRAIYWSRSRGKLWR
KGEESGHVQKLHEMRLDCDADVIILMVEQIGDIACHTGRHSCFYRVYEDGEWKTVEPVLK
DPHAIYSAGH
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggctggaccagatcaaatgggatgcggacggcctggtgccggccatcgcc
caggatcacaagaccgggcgcgtgctgatgatggcctggatgaaccgcgaggccctgagc
ctgactgccgccgagaaccgcgccatctattggtcacgttcccgtggcaagctatggcgc
aagggcgaagagtccgggcacgtacagaagctgcatgaaatgcgcctggactgcgacgct
gacgtgatcatcctgatggtcgagcagatcggcgacattgcctgtcacaccggccgccac
agctgtttctaccgcgtctatgaagatggcgagtggaaaaccgtcgaaccggtcctcaag
gacccgcacgcgatctattctgcaggacactga

DBGET integrated database retrieval system