KEGG   Pseudomonas protegens Pf-5: PFL_0424Help
Entry
PFL_0424          CDS       T00249                                 

Gene name
hisI1
Definition
phosphoribosyl-AMP cyclohydrolase (EC:3.5.4.19)
Orthology
K01496  
phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfl01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pfl00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(487854..488246)
Genome map
AA seq 130 aa AA seqDB search
MKDWLDQIKWDADGLVPAIAQDHKTGRVLMMAWMNREALSLTAAENRAIYWSRSRGKLWR
KGEESGHVQKLHEMRLDCDADVIILMVEQIGDIACHTGRHSCFYRVYEDGEWKTVEPVLK
DPHAIYSAGH
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggctggaccagatcaaatgggatgcggacggcctggtgccggccatcgcc
caggatcacaagaccgggcgcgtgctgatgatggcctggatgaaccgcgaggccctgagc
ctgactgccgccgagaaccgcgccatctattggtcacgttcccgtggcaagctatggcgc
aagggcgaagagtccgggcacgtacagaagctgcatgaaatgcgcctggactgcgacgct
gacgtgatcatcctgatggtcgagcagatcggcgacattgcctgtcacaccggccgccac
agctgtttctaccgcgtctatgaagatggcgagtggaaaaccgtcgaaccggtcctcaag
gacccgcacgcgatctattctgcaggacactga

DBGET integrated database retrieval system