KEGG   Pseudomonas protegens Pf-5: PFL_0742Help
Entry
PFL_0742          CDS       T00249                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PFL_0742 (recD)
Enzymes [BR:pfl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PFL_0742 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
866557..868638
Genome map
AA seq 693 aa AA seqDB search
MTQDLFDALDQAPQPAFDLVPLSRAEDLLLLLERWVERGWLRSLDRAFVGFLHELDPGCD
PLVLMAAALTSHQLGHGHVCLDLFETLKEPDFALSLPPEGDAQNGAPALPSQVLMGLEGA
HWCKVLAGSRLVALAADHAESSRQRPLVLSGKRLYLRRYWAYERRIDNALRQRLALAEAT
PENLATRLDGLFGPAKAAGPVDWQKLACALATRGAFSIITGGPGTGKTTTVVRLLALLQG
PAVEARKPLRIRLAAPTGKAAARLTESISLQVRSLAVPDEVREMIPSEVTTVHRLLGNRP
GTRHFRHHAGNRLPLDVLVVDEASMIDLEMMANLLDALPIHARLVLLGDKDQLASVEAGA
VLGDLCRDAEAGWYNPQTRAWLEAVSGENLGASGLQEDSAHQHPLAQQVVMLRHSRRFGE
GSGIGQLARWVNQQQADEARRLLAARSHADLYGLSLKGEQDRALERLLLEGHGEGPQGYR
HYLNVLRSQRPPPGTPLEDRRWTDWARHVLQAFDRFQLLCAVRKGPWGVEGLNLRITQAL
FKARLIDSDQQWYEGRPVLMTRNDYGLGLMNGDIGIALKLPEQEGSEAGRQVLRVAFPRN
DGQGGVRLVLPSRLNDVETVYAMTVHKSQGSEFAHTALILPDALNPVLTKELIYTGITRA
KDWFSLIEPRAGVFEEAVRRKVKRLSGLMLELD
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggacctgttcgatgcactggaccaggcgccgcaaccagccttcgacctggtg
cccctgagccgcgccgaggacttgctgctgttgcttgagcgctgggtcgagcgcggctgg
ctgcgttccctggaccgggcctttgtcggcttcctgcatgagctggacccgggctgtgat
ccgctggtactgatggccgcggccctgaccagccatcagctggggcacgggcatgtctgc
ctggacctgttcgaaaccctcaaggagccggacttcgccctgtcgctgccgcccgaaggc
gacgcacaaaacggcgcaccggcgctgccgtcccaggtgttgatggggcttgaaggggcg
cactggtgcaaggtcctggccggcagccgcctggtggccctggcggcggatcatgccgag
tcttcccggcagcggccgctggtgctgtccggcaagcgcctgtacctgcgccgctactgg
gcctatgagcggcgtatcgacaacgccttgcgccagcgcctggccttggccgaggccacg
ccggaaaacctcgcgacgcgcctcgacgggctgttcggcccggccaaggcggcggggccc
gtcgactggcagaaactcgcctgtgccctggccacccggggcgccttcagcatcatcacc
ggcggccccggcaccggcaagaccaccaccgtggtgcgcctgctggccttgctccagggc
ccggcggtggaagcacgcaagccgctgcgcattcgcctggcggcgcctaccggcaaggcc
gcggcgcgcctgaccgagtccatcagcttgcaggtgcgttccctcgcggtgcccgatgag
gtgcgggaaatgatccccagcgaggtgaccaccgtgcaccgcttgctgggcaatcgcccg
ggcacccggcatttccgccatcacgccggcaaccgcttgcccctggatgtcctggtggtg
gacgaagcctcgatgatcgacctggaaatgatggccaacctgctggacgccttgcccatc
catgcacgcctggtgttgctgggggacaaggaccagctggcctcggtggaagccggcgcc
gtgctcggcgacctgtgccgtgacgccgaggccggttggtacaacccgcagacccgggcc
tggctggaggcggtcagtggcgagaacctgggagccagcggcctgcaggaagacagcgcc
caccagcatcccctggcgcagcaggtggtgatgctgcgccattcccggcgtttcggcgaa
ggcagcggcatcggccagctggcgcgttgggtcaaccagcagcaggccgatgaagcccgg
cgcctgctggcggctcgcagccatgccgacctgtatggcctgagcctcaagggcgagcag
gatcgggccctggagcggctgctgctggagggccatggcgaggggccgcaaggctaccgc
cactacctgaatgtactgcgcagccagcgcccgccgccgggtacgcctctggaggatcgg
cgctggaccgactgggcgcgccatgtcctgcaggcctttgatcgcttccaattgctgtgc
gcggtgcgcaagggcccctggggtgtcgaaggcctgaacctgcggatcacccaggcgctg
ttcaaggcccggctgatcgacagtgaccagcaatggtacgagggccgcccggtgctgatg
acccgcaacgattacggcctgggcctgatgaacggtgatatcggcatcgccctgaaactg
cctgagcaggaaggctcggaggcggggcgtcaggtgctgcgcgtcgcctttccgcgcaac
gatggccagggcggggtgcggttggtgctgccaagccggctcaatgacgtggaaaccgtt
tacgccatgactgtgcataagtcccagggctcggagttcgcccacaccgcgttgatcctg
cccgacgctttgaacccggtgctgaccaaggagctgatctacaccggtatcacccgggcc
aaggactggttcagcctgatcgagccccgtgccggagtgttcgaagaggctgttcggcgc
aaggtcaagcgtctgagcgggttgatgctggagttggactga

DBGET integrated database retrieval system