KEGG   Pseudomonas protegens Pf-5: PFL_0837Help
Entry
PFL_0837          CDS       T00249                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pfl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
967518..968369
Genome map
AA seq 283 aa AA seqDB search
MTSVPSSTRLPCGNRVLDLAHAHVMGILNVTPDSFSDGGRFSQLDLALRHAEAMVAAGAT
LIDVGGESTRPGARAVSPLEELERVAPVVERIHRELDVIISVDTSTPAVMRETARLGAGL
INDVRSLRREGALDAAAATGLPVCLMHMLGEPGDMQDNPHYQDVTREVAEFLVERMAQCA
SVGIGPERIVLDPGFGFAKTLQHNLSLFKHMDALHALGRPLLVGVSRKSMIGQALNRPVG
ERLHGSLALAALAVAKGAKIIRVHDVAETVDVVRMIAAVESAE
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgttccttcctccacccggttgccttgcggcaaccgggttcttgatttggcc
catgcacatgtcatgggtatcttgaatgtaactcccgactccttctctgatggtggccgc
ttcagccagcttgatctggctttgcggcatgccgaggccatggttgcggccggtgctacg
ctgattgatgtcggtggcgaatccactcgcccgggtgcccgtgcggtatcgccgctggag
gagttggagcgagtcgcgcctgtggtcgagcgcatccaccgtgagttggatgtgatcatt
tctgttgatacctcgacaccggcggtgatgcgtgaaaccgctcgcctcggcgcagggctg
atcaatgacgttcgttcattgcgccgggagggtgccctggatgcggcggcggccactggc
ttgccggtgtgtctgatgcacatgctgggtgagcccggtgatatgcaggacaacccgcat
tatcaggacgtgacccgagaggttgccgagttcctggttgagcgcatggcccagtgtgcg
tcagtgggcatcggtccagagcggattgtgctcgatccgggctttggctttgccaagacc
ctgcaacacaacctgagcctgttcaagcatatggatgccttgcatgcacttgggcgcccg
ttgttggttggggtgtcgcgcaagagcatgattggccaggccttgaatcgccccgtaggt
gagcgattgcacggcagtctggcgctagcggccctggcagtggccaagggcgcgaaaatt
atccgtgtccatgatgtcgccgagaccgtggatgtggtgcgaatgattgcggcagtggaa
tccgccgaataa

DBGET integrated database retrieval system