KEGG   Pseudomonas protegens Pf-5: PFL_0839Help
Entry
PFL_0839          CDS       T00249                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFL_0839 (tpiA)
   01230 Biosynthesis of amino acids
    PFL_0839 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFL_0839 (tpiA)
   00051 Fructose and mannose metabolism
    PFL_0839 (tpiA)
   00562 Inositol phosphate metabolism
    PFL_0839 (tpiA)
Enzymes [BR:pfl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PFL_0839 (tpiA)
Exosome [BR:pfl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PFL_0839 (tpiA)
  Exosomal proteins of bladder cancer cells
   PFL_0839 (tpiA)
  Exosomal proteins of melanoma cells
   PFL_0839 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
969790..970545
Genome map
AA seq 251 aa AA seqDB search
MRRPMVAGNWKMHGTRASVAELINGLRHLALPSGVDVAVFPPCLYINQVIDGLKGKSIQV
GAQNSAVESMQGALTGEIAPSQLVDAGCSLVLVGHSERRLIMGERDATLNRKFAAAQACG
LKPVLCVGETLEQREAGKTLEVVGRQLGSIIEELGVGAFANAVIAYEPVWAIGTGLTATP
QQAQDVHAAIRAQLAAENSEVARGVRLLYGGSVKAANAVELFGMPDIDGGLIGGASLNAD
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgccctatggtagctggtaactggaagatgcacggtacccgcgccagcgtcgct
gagctgatcaacggccttcgtcatctggccttgccaagcggtgttgatgtcgcggtattc
ccgccttgcttgtatatcaatcaagtgattgatggcttgaagggtaagtcgattcaggtc
ggcgcgcagaactctgcggtggaatccatgcaaggtgcattgacgggcgagatcgccccg
agtcagttggtggatgcaggttgttccctggtgctggttgggcactctgagcgccgcctg
atcatgggtgagcgtgacgcgactctcaatcgcaagttcgcagcggcgcaggcctgtggc
ttgaagccggttctgtgtgtaggggagaccctcgagcagcgcgaagccgggaagactcta
gaggttgtcgggcgtcagctgggcagcatcatcgaagagttgggtgttggtgcgttcgcc
aatgctgttatcgcttacgagccggtctgggccattggtaccgggctgactgcgacaccg
cagcaggcgcaggatgtgcacgcagctatccgcgcgcagttggcggcagaaaattctgaa
gtggcacgaggtgtgcggcttctatacggcggcagcgtgaaggcggccaatgcggtcgaa
ctgttcggcatgccggatatcgatggggggctcattggtggagcttccctgaatgcagat
gagttcggtgcgatctgtcgcgccgcgggaaactga

DBGET integrated database retrieval system