KEGG   Pseudomonas protegens Pf-5: PFL_0862Help
Entry
PFL_0862          CDS       T00249                                 

Definition
PhoD family protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFL_0862
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PFL_0862
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PFL_0862
Enzymes [BR:pfl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PFL_0862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
997596..999137
Genome map
AA seq 513 aa AA seqDB search
MSEFNLGRRRIIQIAGAGLLMPSLAPAVIASVKDRPQLTDGVQSGDLLGDKAMIWSRSDR
PARMVVEWDTRSMFSNPRRFISPLADARTDFTARVELTGLPADQAIFYRVTFEDAQSGAA
SEPWFGHLRSAPLQRRDIRFVWSGDTVGQGFGINPDIGGMRIYEAMRLRLPDFFIHSGDT
IYADGPVPAQLTVEDGRIWRNLTTEAKSKVAETLDEYRGNYRYNLMDENLRRFNAEVPQI
WQWDDHEVVNNWSPSKQLDERYVVKDIQTLVGRARQAWLEYSPMRRQSADGGGRIYRKLS
YGPLLDVFVLDMRSYRGPNDDNLGGEKPFLGREQLDWLKRELKDSSAQWKVVAADMPIGL
GVPDGEVSPGVARWEAIANGDPGPAQGRELEIAELLAYLRKHQVRNHVWLTADVHYCAAH
HYHPDRAAFQDFEPFWEFVAGPLNAGSFGPNVLDKTFGPEVVFQKAPPAQNTSPFAGFQF
FGEVQIDGQTAELKVILRDLDGVAVYEHNLQPV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagttcaacctcggccgtcgtcggatcatccaaatcgccggggcggggctgttg
atgccgagcctggcgccggcggtgatcgcttcggtcaaggatcggccgcagctcaccgac
ggggtgcagtccggggatctgctgggggataaggcgatgatctggagccgcagcgatcgt
ccggcgcggatggtggtggagtgggacacgcgaagcatgttcagcaacccccggcgtttc
atctcgcccctggccgatgcccgcaccgacttcacggcgcgggtggagttgaccgggctg
ccggccgatcaggcgatcttctatcgggtgaccttcgaggatgcccagtccggcgcggcc
agcgagccctggttcggccatttgcgcagtgcgcctttgcaacgccgggacatccgtttt
gtctggagcggcgacacggttgggcagggcttcggcatcaacccggatatcggcggcatg
cgcatctacgaggcaatgcgcctgcgcctgccggacttctttatccacagcggcgacacc
atctacgccgacggcccggtgccggcgcagttgaccgtggaagacgggcgcatctggcgc
aacctcaccaccgaggccaagagcaaagtggccgagaccctcgacgaataccggggcaac
taccgctacaacctgatggacgaaaacctgcgccgtttcaacgccgaggtgccgcagatc
tggcagtgggacgaccacgaggtggtcaataactggtcgccgagcaagcagctggacgaa
cgttacgtggtcaaggacatccagaccctggtgggccgcgcgcgccaggcctggctggag
tattctcccatgcgccggcagagcgccgatggcggcgggcgcatctaccgcaagctcagc
tatgggccgttgctggatgtgttcgtgctggacatgcgcagctatcgcggccccaacgat
gacaacctcggcggcgagaaacctttcctcggccgcgagcaactggattggctgaagcgt
gagctcaaggactcctcggcccagtggaaagtggtggcggcggacatgcccattggcctg
ggcgtgcccgatggcgaagtcagccccggggtggcgcgctgggaggcgatcgccaacggc
gacccgggcccggcccagggccgcgagctggagattgccgagctgctggcgtatttgcgc
aagcatcaggtgcgcaaccatgtgtggctgacggcggacgtgcactactgcgcggcccac
cactaccacccggatcgcgcggcatttcaggatttcgaaccgttctgggagtttgtcgcc
ggcccgctgaatgccgggagttttgggcccaatgtgctggacaagaccttcggcccggaa
gtggtgttccagaaggcgccgccagcgcagaacacttcaccctttgccggcttccagttc
tttggcgaagtgcagatcgatgggcagacggcggagctgaaggtgatcctgcgggacctg
gatggcgtggcggtgtacgagcacaacctgcaaccggtgtaa

DBGET integrated database retrieval system