KEGG   Pseudomonas protegens Pf-5: PFL_0929Help
Entry
PFL_0929          CDS       T00249                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PFL_0929 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    PFL_0929 (hisD)
Enzymes [BR:pfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PFL_0929 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1069761..1071089
Genome map
AA seq 442 aa AA seqDB search
MTAPTAIRRLNAADPDFARHLDHLLSWESVSDDSVNQRVLDIIKAVRERGDAALVEFTQR
FDGLQVASMADLILPRERLELALTRITVAQREALEKAAARVRSYHEKQKQDSWTYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVTEVVMVVPTPRGEVNELVLA
AACIAGVDRVFTIGGAQAVAALAYGTESVPQVDKVVGPGNIYVATAKRHVFGQVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAEFLDKVAASIAKLLPTMER
AEIINTSINGRGALIKVRDMQQAIEVANRIAPEHLELSVADPQAWLPQIRHAGAIFMGRH
TSEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEQGASELGRTASVLARG
ESLTAHARSAEYRIVDDQDQGQ
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccgactgcaattcgccgactcaacgctgccgacccggatttcgcccgtcat
ctggatcatctgctgagctgggaaagtgtctctgacgattcggtcaatcagcgggtgctg
gacatcatcaaggccgtgcgcgagcgcggcgatgcggcgctggtggagttcacccagcgt
ttcgacggcttgcaagtggcctccatggcagacctgatcctgccgcgcgagcgcctggag
ctggccctgacccggatcaccgtggcccagcgcgaagccctggaaaaggccgcggcgcgg
gtgcgcagctaccacgagaagcagaaacaggactcctggacctacaccgaggccgacggc
acggtgctgggccagaaggtcacgccgctggaccgcgccgggctgtacgtaccggggggc
aaggcgtcctacccgtcgtcggtgctgatgaacgcgattccggccaaggtggcgggcgtt
accgaggtggtgatggtggtgccgaccccgcgtggcgaggtcaacgaactggtgctggct
gccgcctgcatcgccggggtcgatcgggtgttcaccatcggcggcgcccaggccgtggcc
gcgctggcctacggcaccgaaagcgtgccccaggtggacaaggttgtcggcccgggcaac
atctatgtggccaccgccaagcgccacgtgttcggccaggtcggcatcgacatgatcgcc
ggcccgtcggagatcctggtggtctgcgacggtcagaccgacccggactggatcgccatg
gacctgttctcccaggccgagcacgacgaagacgcccaggcgatcctggtcagcccggat
gccgagttcctggataaagtcgcggcgagcatcgccaagctgctgccaaccatggagcgc
gcggaaatcatcaacacctcgatcaatggccgtggagccctgatcaaggtccgcgacatg
cagcaagccattgaagtggccaaccgcattgcccccgagcacctggagctgtccgtggcc
gacccgcaagcctggctgccgcagatccgccacgccggggcgatcttcatgggccgccac
accagcgaagcgctgggggattactgcgccgggccgaaccacgtgctgccgacttccggc
accgcgcgtttctcgtcgccgctgggggtgtatgacttccagaaacgttcgtcgatcatc
ttctgctccgagcagggcgcctctgaactgggccgcaccgcctcggtgctggcccgtggc
gagtcgctgaccgcccacgcccgcagcgccgaataccgcatcgtcgacgaccaagatcag
gggcaatga

DBGET integrated database retrieval system