KEGG   Pseudomonas protegens Pf-5: PFL_0949Help
Entry
PFL_0949          CDS       T00249                                 

Gene name
folE1
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pfl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1090618..1091178)
Genome map
AA seq 186 aa AA seqDB search
MTLSLPQHYREILKDLGEDPEREGLLDTPKRAAKAMQYLCHGYGQSLEDIVNGALFASDS
DEMVIVADIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKIARIVDMFARRLQIQENLT
REIADAVQSVTQAAGVAVVIEAKHMCMMMRGVEKQNSTMHTSVMLGAFRDSSTTRQEFLQ
LIGRSK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaccctttccctgccccagcactatcgcgagatcctcaaggacctgggcgaagacccc
gagcgcgaaggcctgctcgatacccccaagcgcgcggccaaggccatgcagtacctgtgt
cacggctacggccagtcgctggaggacatcgtcaacggcgcgctgtttgcttccgacagc
gatgaaatggtgatagtcgccgacatcgagctgtattccctgtgcgaacatcacctgctg
cccttcatcggcaaggcccatgtggcttatattcctaccggcaaggtcctggggctgtcg
aagatcgcgcggatcgtcgacatgttcgccaggcgcctgcagatccaggaaaatctcact
cgggaaatcgccgacgcggtacagagcgtgactcaggccgccggcgtcgcggtggtgatc
gaggccaagcacatgtgcatgatgatgcgcggcgtcgagaaacagaattccaccatgcat
acctcggtgatgctcggcgccttccgcgattcgagcaccactcgccaggaattcctgcaa
ttgattggacggagcaagtag

DBGET integrated database retrieval system