KEGG   Pseudomonas protegens Pf-5: PFL_0950Help
Entry
PFL_0950          CDS       T00249                                 

Definition
dihydromonapterin reductase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFL_0950
   00670 One carbon pool by folate
    PFL_0950
Enzymes [BR:pfl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PFL_0950
    1.5.1.-  
     PFL_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1091202..1091912)
Genome map
AA seq 236 aa AA seqDB search
MNTSPAPILITGASQRVGLHCALRLLQDGQPVIVTYRSQRPGLEALREKGATLLFADLSS
EAGILALINELKNRTQSLRAIVHNASEWLEESPGDEAAAFARMFGVHMLAPYLINLHCAE
LLQRSSPADIIHISDDVTRKGSSKHIAYCASKAGLDSLTLSFAAKYAPTIKVNGIAPALL
LFNPDDDAAYRAKTLAKSALGIEPGSEVIYQSLRYLLDNPYVTGTTLTVNGGRHLK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctctcctgccccgatcctgatcaccggcgccagccagcgagtcggcctgcat
tgcgccctgcgcctgctccaagacgggcagccggtgatcgtcacctaccgcagccagcgc
ccgggccttgaggccctgcgagaaaagggcgcgaccctgctgttcgccgatctctccagc
gaagccgggatcctggccctgatcaacgagctgaaaaaccgtacccagagcctgcgggcc
atcgtccacaacgcctcggaatggctggaggagagccctggcgacgaagcagcggccttt
gcccggatgttcggcgtgcacatgctggcgccctacctgatcaacctgcattgcgccgag
ttgctgcagcgctcgagcccggcagacatcatccacatcagcgacgacgtgactcgcaag
ggcagcagcaagcacatcgcctactgcgccagcaaagccggcctggacagcctgaccctg
tccttcgcagcgaaatacgccccgacaatcaaggtcaacggcattgccccggccctgcta
ttgttcaaccccgacgacgacgcggcgtaccgcgccaagaccctggccaaatccgcgctg
ggcatcgaacccggcagcgaagtgatttaccagagcctgcgctatctgctggacaacccc
tatgtcaccggcaccaccctgaccgtcaacggcgggcggcacctcaagtaa

DBGET integrated database retrieval system