KEGG   Pseudomonas protegens Pf-5: PFL_1134Help
Entry
PFL_1134          CDS       T00249                                 

Definition
chemotaxis-specific methylesterase
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PFL_1134
Enzymes [BR:pfl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PFL_1134
Two-component system [BR:pfl02022]
 CheA family
  WspE-WspRF
   PFL_1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1301439..1302449
Genome map
AA seq 336 aa AA seqDB search
MKIAIVNDMPMAVEALRRALAFDPSHEVVWVATNGAEAVKYCAELTPDLILMDLIMPVMD
GVEATRRIMAESPCAIVIVTVDRQQNVHRVFEAMGHGALDVVDTPALGAGNAQEAAAPLL
RKILNIGWLIGQRGSRVRSAPQPLRSGAPRQSLVAIGSSAGGPAALEVLLKGLPKDFAAA
IVLVQHVDQVFAAGMAEWLSSASGLEVRLAREGEPPQSGKVLLAGTNHHIRLLKNGTLAY
TAEPVNEIYRPSIDVFFESVASFWNGDAVGVLLTGMGRDGAQGLKLMRDQGYLTIAQDQN
SSAVYGMPKAAAAIGAASEIRPLDKIAPRLLEIFAK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagcgatagtcaatgacatgcccatggccgtggaggccctgcgccgtgccctg
gccttcgaccccagccacgaggtggtgtgggtcgccaccaatggtgcggaagcggtgaag
tactgtgccgaactgaccccggacctgattctcatggacctgatcatgccggtgatggat
ggcgtcgaggccacgcggcggatcatggccgagtcgccgtgcgccatcgtgatcgtcacc
gtcgatcgccagcagaatgtgcaccgggtgttcgaagccatgggccacggcgcgctggat
gtggtggacacgccggccctgggcgcgggcaatgcccaggaagcggcggcgccactgttg
cgcaagatcctcaatatcggctggctgatcggccagcgcggcagccgggtgcgttccgcg
ccccagccactgcgcagcggtgcgccacgccagagcctggtggccattggctcctccgcg
ggtgggccggcggctctggaagtgttgctcaagggcttgccaaaggactttgccgccgcc
atcgtgctggtccagcacgttgatcaggtgtttgccgcaggcatggccgaatggctcagc
agtgcctccggcctggaggtgcgcctggcccgggaaggcgagccgccgcaaagcggcaag
gtcctgctggcgggcaccaaccatcatatccgtctattgaagaacggcaccctggcctat
accgccgagccggtgaacgagatctaccggccctccatcgatgtgtttttcgagagcgtt
gccagtttctggaatggcgatgcggtgggggtgctgctgaccggcatgggccgtgacggc
gcccagggcttgaagctgatgcgtgatcagggttatctgaccatcgcccaggaccagaac
agcagtgcggtgtatggcatgcccaaggcggccgctgccatcggcgccgcctcagagatt
cgcccgctggacaagatcgctccacgtttgctggagatatttgccaaatga

DBGET integrated database retrieval system