KEGG   Pseudomonas protegens Pf-5: PFL_1165Help
Entry
PFL_1165          CDS       T00249                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PFL_1165 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    PFL_1165 (dapE)
Enzymes [BR:pfl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PFL_1165 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1332622..1333773)
Genome map
AA seq 383 aa AA seqDB search
MTAHAELSPTLQLACDLIRRPSVTPIDADCQKLMMQRLGDAGFKLEPMRIEDVDNFWASH
GQHEGPVLCFAGHTDVVPTGPVQAWQNDPFDALIDEHGMLCGRGAADMKGSLAAMLVAAE
RFVTDYPDHKGSVAFLITSDEEGPAHHGTKAVVERLAARKERLDWCIVGEPSSTSLVGDV
VKNGRRGSLGAKLTVRGVQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQ
ISNLNSGTGATNVIPGDLVAVFNFRFSTESTVEGLQQRVAAILDKHGLDWHVEWALSGLP
FLTEPGALLDAVSASIKQVTGRDTKASTSGGTSDGRFIATLGTQVVELGPVNATIHQVNE
RVLASDLDVLTEIYYQTLIKLLA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgacggcccatgccgagctttcgccgaccctgcaacttgcctgtgatctgatccgtcgc
ccctcggtgacgccgatcgacgccgactgccagaagctgatgatgcagcgcctgggggat
gccggcttcaagctggaaccgatgcgcatcgaggacgtggacaacttctgggccagccat
ggccagcatgaaggcccggtgctgtgttttgccggccacaccgacgtggtgcctaccggc
ccggtccaggcctggcagaacgacccgttcgacgctctgatcgacgagcacggcatgctc
tgcggccgtggcgcagcggacatgaagggcagcctggcggccatgctggtagccgctgag
cgtttcgtcaccgactacccggaccacaagggctcggtagccttcctcatcaccagcgac
gaagaaggccccgcgcaccatggcaccaaggccgtggtggagcgcctggcggcacgcaag
gagcgcctggactggtgcatcgtcggtgagccttcgagcaccagcctggtgggcgacgta
gtcaagaacggccgccgcggctccctcggcgccaagctcaccgtgcgcggggtgcagggc
cacgtggcctacccgcacctggcgaagaacccgatccacctggcggcaccggccctggcg
gaactggcggcggagcactgggatgacggcaacgccttcttcccacccaccagtttccag
atctccaacctcaattccggcaccggcgccaccaacgtgatccccggtgatctggtggcg
gtgttcaacttccgcttctccaccgaatccacggtggaaggcctgcagcagcgggtcgcg
gccatcctcgacaagcacggcctggactggcatgtggagtgggccctgtccggcctgccg
ttcctcaccgaacccggcgccctgctggacgcggtatcggccagcatcaagcaggtcacc
gggcgcgacaccaaggcctccaccagtggcggcacctccgacgggcgcttcatcgccacc
ctgggcacccaggtggtggaactgggcccggtcaacgccaccatccatcaggtcaacgag
cgggtactggccagcgacctcgatgtgctgaccgaaatctactaccagaccctgatcaag
ttgctcgcctga

DBGET integrated database retrieval system