KEGG   Pseudomonas protegens Pf-5: PFL_1205Help
Entry
PFL_1205          CDS       T00249                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pfl  Pseudomonas protegens Pf-5
Brite
Enzymes [BR:pfl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PFL_1205 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1379526..1380203
Genome map
AA seq 225 aa AA seqDB search
MAREQDDLLRRGIGMTSQRTRERLIQRLYDEGLSNPQVLEVIRRTPRHLFVDEALAHRAY
EDTALPIGHNQTISQPYMVARMSELLLAAGPLDKVLEIGTGSGYQTAVLSQLVERVFSVE
RIKVLQDRAKERLQELNLRNVVFRWGDGWEGWPALAPYNGIIVTAVATDIPQALLDQLAP
GGRLVIPVGAGEVQQLMLIIREEQGFARHVLGAVRFVPLLNGPLA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgagcaagacgatctgctgcggcggggaatcggcatgacttcccagcgtacc
cgcgaacgcctgatccagcgcctgtatgacgaggggttgtccaaccctcaggtactggaa
gtgattcggcgcacaccgcggcatctgtttgtcgatgaggccctggcccatcgtgcctat
gaagacacggcgctgccgatcggccacaaccagaccatctcccagccttatatggtggcc
cgcatgagtgagctgctgctggcggccgggccgctggacaaggtactggagatcggtacc
ggctcgggctaccagacggcggtgttgtcgcagctggtggagcgggtgttttcggtggag
cggatcaaggtcctgcaagaccgggccaaggagcgcctgcaggaattgaacctgcgcaac
gtcgtgtttcgctggggcgacggctgggaaggctggccggcgctggcgccctataacggc
atcatcgtcactgccgtcgccaccgatatcccgcaggccctgctcgatcaactcgcgcct
ggcgggcgcctggtgattccggtgggggcaggggaggtgcagcagttgatgctgatcatc
cgtgaagaacagggctttgcccggcacgtcctgggggcggtgcgttttgtgccgttgctc
aatggtcccctggcctga

DBGET integrated database retrieval system