KEGG   Pseudomonas protegens Pf-5: PFL_1671Help
Entry
PFL_1671          CDS       T00249                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pfl02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pfl02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1875502..1876623
Genome map
AA seq 373 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSADSNIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDFLPKNFEDISRNPEKVKQ
LLCEKVHSISRSNRRFSSYSAPAPQPASAPAPAPSSFASSRSPAPAPAPARAAAPAASAN
SPAPKRKAYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFAERLDKL
CRISVKEAEDGDILRPGLALLAPGGKQMMVDGRGAVKILPGDERLNYKPCVDITFGSAAK
SYSDKVLAVVLTGMGADGREGARLLKQGGSAVWAQDEASCVIYGMPMAIVKANLADAVYS
LDDIGRHLVEACL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaagtcctggtggtggacgattcgggttttttccgccgccgcgtctcggaa
attctttcagcggattcgaatatccaggtcgtcggcacggcgaccaatggtaaagaggcg
atcgatcaggccctggcgctcaagccggacgtgatcaccatggactacgagatgccgatg
atggatggcatcaccgcagtgcggcacatcatgcagcgctgcccgacgccggtcctgatg
ttctcctccctgacccacgaaggcgcccgagtgaccctcgatgcgctggatgccggggcg
gtggactttctgccgaagaacttcgaggacatctcgcgcaatcccgagaaggtcaagcag
ttgctgtgcgagaaggtccacagtatctcgcgcagcaatcggcgcttcagcagctacagt
gctccggcaccgcagccggcgagtgcgccggcacctgctccttcgagcttcgccagttcg
cgctcgccagctcccgcaccggctccggcccgcgcagcggcgccggcggccagtgcgaat
tcgccggcacccaagcgcaaggcctacaagctggtggccattggtacgtccacaggcggc
ccggtggcgctgcagcgggtcctgacccagctgccggccaacttcccggcacctatcgtg
ctgatccagcatatgccggcggccttcaccaaggcctttgccgagcgtctggacaagctc
tgccgcatcagcgtcaaggaagccgaggatggcgacatcctgcgtccgggcctggcgctg
ctggcgcctggcggcaagcagatgatggtcgacggtcgtggtgcggtgaagattctcccg
ggcgatgagcgcttgaactacaagccgtgcgtggatatcaccttcggctctgcggccaag
tcctacagcgacaaagttctggcggtggtgctcaccggcatgggcgccgacggtcgcgaa
ggcgcgcgtctgctcaagcagggcggcagtgcggtctgggcccaggacgaggccagctgt
gtgatctatggcatgccaatggccatcgtcaaggccaacctggcggatgcggtgtacagc
ctggacgacatcggccggcacctggtcgaggcctgtctctga

DBGET integrated database retrieval system