KEGG   Pseudomonas protegens Pf-5: PFL_1715Help
Entry
PFL_1715          CDS       T00249                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:pfl01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pfl00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pfl00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:pfl00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1918727..1919095
Genome map
AA seq 122 aa AA seqDB search
MVTSVTNLSRSGLYDWMAQRVSAVVLAAYFIFLIGYLVANPGIDYTQWHGLFANNWMRIF
SLLAMVALGAHAWVGMWTISTDYLTPMALGKSATAVRFLFQAVCGVAMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccagcgttacgaacctgtcgcgttcgggcctttatgactggatggcacagcgt
gtgtctgcggtcgttctcgcggcttatttcattttcctgatcggatacctcgtagcgaat
ccgggcattgactacacccagtggcatggcctgttcgcaaacaactggatgcgtatcttc
agtctgctggccatggtggccctgggcgctcacgcctgggtcggcatgtggaccatctcg
actgactacctgacgccgatggcgctgggcaagtcggccacagcagtacgtttccttttc
caggcagtatgcggcgtcgcgatgttcgcttacttcgtctggggtgtgcagattctctgg
ggtatctga

DBGET integrated database retrieval system