KEGG   Pseudomonas protegens Pf-5: PFL_1719Help
Entry
PFL_1719          CDS       T00249                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFL_1719 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFL_1719 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PFL_1719 (sucB)
Enzymes [BR:pfl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PFL_1719 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1924726..1925949
Genome map
AA seq 407 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKQPGDAVKRDELIVDIETDKVVLEVLATADGVLGAIV
KNEGDTVLSDEVLGSIVEGGAAAAAPAAAAAPAAAAAAPAAADGEDDPIAAPAARKLAEE
NGINIASVAGTGKGGRVTKEDVVAAVAAKKAAPAAAPAKAPAPAAGAPVFAAGDRVEKRV
PMTRLRAKVAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMSFF
VKAATEALKRFPAVNASIDGSDIVYHGYADIGVAVSSDRGLVVPVLRNAELMSLAEIEGG
IATFGKKARDGKLSMEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNILQRPMAI
NGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagcccccactttcccggaatcggttgccgatggcaccgttgcc
acctggcacaagcaaccgggcgacgccgtcaagcgtgacgagctgatcgttgacatcgag
accgacaaggtcgtgttggaagttctggccaccgctgacggcgtgctgggcgctatcgtc
aagaacgaaggcgacaccgttctgtccgacgaagtcctgggctccatcgttgaaggcggc
gctgctgccgctgctcctgctgccgccgccgctccggccgccgccgctgctgccccggct
gctgccgatggcgaagacgatccaatcgctgctcctgccgcgcgcaagctggctgaagaa
aacggtatcaacatcgcttccgttgccggtaccggcaaaggcggccgtgtgaccaaggaa
gacgtggtcgctgctgttgccgcgaagaaagccgctccggctgccgcgcctgccaaggct
ccggctcctgccgctggtgctccggtcttcgctgccggtgatcgcgtcgagaagcgcgtg
cctatgacccgcctgcgtgccaaggttgccgagcgtctggttgaagcccagtcgaacatg
gcgatgctgaccaccttcaacgaagtcgacatgactgaagtcatggccctgcgttcgaag
tacaaggacctgttcgagaagtcccacaatggcgtacgcctgggcttcatgtcgttcttc
gtcaaggccgccaccgaagccctgaagcgcttcccggctgtcaacgcctcgatcgacggt
tccgacatcgtctaccacggctatgccgacatcggtgttgcggtctccagcgaccgtggc
ctggtggttccggttctgcgtaacgccgaactgatgagcctggccgaaatcgaaggcggc
atcgccaccttcggcaagaaggcccgtgacggcaagctgtcgatggaagagatgaccggt
ggtactttcaccatcaccaacggtggtactttcggttcgatgatgtctaccccgatcgtc
aacccgccacaagccgcgatcctgggcatgcacaacattctgcagcgtcctatggcgatc
aacggtcaagtggtcatccgtccgatgatgtacctggcgctgtcctacgatcaccgcctg
atcgacggtaaagaagccgtgacgttcctggtgaccatcaagaacctgctggaagacccg
gctcgtctgctcctggacatctaa

DBGET integrated database retrieval system