KEGG   Pseudomonas protegens Pf-5: PFL_1951Help
Entry
PFL_1951          CDS       T00249                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pfl00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pfl00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2178109..2179119
Genome map
AA seq 336 aa AA seqDB search
MTAGLQGSLMVDVAGTWLTAEDRQLLRQPQVGGLIIFARNIEHPRQVRELCAAIRAIRPD
LLLAVDQEGGRVQRLRQGFVRLPAMRALADNPNAEYLAEQCGWVMATEVLAVGLDLSFAP
VLDLDHQRSAVVGSRAFEGDPEQAALLAGAFIRGMNSAGMAATGKHFPGHGWAEADSHVA
IPNDERSLDEIRAKDLLPFARLSKRLAAVMPAHVIYPQVDPQPAGFSRYWLQDILRGELQ
FDGVIFSDDLSMAGAHVVGDAASRIEAALTAGCDMGLVCNDRAAAELALSAVQRLKVQPS
PRIARMRGQAFANIEYKQDPRWLAALGALKDAQLID
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactgctggcctgcaaggctctttgatggtggacgtcgccggtacctggctgacggcc
gaagatcgccaactcctgcgccagccgcaggtcggtgggttgatcatctttgcccgcaat
atcgaacatccgcgccaggtacgggagctgtgcgcggcgattcgcgcgattcgcccggac
ctgttgttggccgtggaccaggagggcggccgggtgcagcgtctgcgccagggctttgtg
cgcctgccggccatgcgtgccctggccgacaatccgaatgccgagtacctggccgagcag
tgtggctgggtcatggccaccgaggtcctggcggtggggctggacctgagcttcgccccg
gtactggacctcgatcaccagcgcagcgcggtggtgggcagccgggctttcgagggcgac
cccgagcaggcggcgttgctcgccggtgcgtttatccgcggtatgaacagcgccggcatg
gccgctaccggcaagcactttcccgggcacggctgggccgaggccgactctcatgtggcg
atccccaatgacgagcgcagtctggatgaaatccgtgccaaggacctactgccctttgct
cgtctgagcaagcggttggcggcagtgatgcctgcgcacgtcatctatccgcaagtcgac
cctcaaccggccggcttctcgcgctactggttgcaggacatcctgcgtggcgagctgcaa
tttgacggggtgatcttcagcgatgacctgtccatggccggcgcccatgtcgtcggggac
gcggcaagccggatcgaagcggcgctgaccgccggttgcgacatggggctggtatgcaat
gaccgtgctgccgccgagctggccctgagtgccgtgcagcgcctcaaggtgcagccttcg
ccacgcatcgcgcggatgcgtggccaggccttcgccaatatcgagtacaagcaggatccg
cgttggttggcggcgctgggtgccctcaaggatgcccagttgatcgactga

DBGET integrated database retrieval system