KEGG   Pseudomonas protegens Pf-5: PFL_2105Help
Entry
PFL_2105          CDS       T00249                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PFL_2105 (rbsK)
Enzymes [BR:pfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PFL_2105 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2326069..2326986
Genome map
AA seq 305 aa AA seqDB search
MSAKVVVVGSLNMDLVTRAERLPRGGETLIGKSFATVSGGKGANQAVAAARLGAQVSMVG
CVGDDAYGEQLRGALLAEQIDCQTVSVVEGSSGVALIVVDDSSQNAIVIVAGGNGQLTPE
KVAGFDGVLQDGQVIICQLEVPLATVGYTLKRGRELGKTVILNPAPASGPLPAQWYGAID
YLIPNESEASALSGVAVDSLESAEVAASRLIAAGAGKVIITLGAQGSLFADGQRFEHFPA
PRVKAIDTTAAGDTFVGGFAAALAAGKSEAEAIRFGQVAAALSVTRAGAQPSIPTLSDVQ
AFIPS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaaaagtagtggtagtgggtagcctcaacatggacctggtgactcgggccgag
cgcctgccccgagggggcgagacgctgattggcaaatccttcgccacggtatccggtggc
aagggcgccaatcaggcggtggctgcggccaggctgggagcgcaggtgtcgatggtcggc
tgtgtcggcgacgatgcctatggcgagcaactgcgaggtgccttgctggccgagcagatc
gattgccagacggtgagtgtggtcgaaggctccagtggggtggcgctgatcgtggtggac
gacagtagccagaatgcgattgtcatagtcgccggcggcaatggccagctcactcccgag
aaggtcgccgggttcgatggggtgctgcaggatgggcaagtcatcatctgccagcttgaa
gtgccgctggcgactgtgggctacaccctcaagcgcgggcgcgaactgggcaagacggtg
atcctcaatccggcgccggccagtggcccgctgccggcgcagtggtatggcgcgatcgac
tacctgattcccaacgagagcgaggcttcggccttgagcggggtagcggtggactccctg
gagagcgctgaagtggctgccagtcgcttgatcgctgcgggtgctggcaaggtgatcatc
accctcggtgcgcaaggctcgctgtttgccgatggccagcgttttgagcatttcccggcg
cccagggtcaaggcaatcgataccacggcggccggggacacctttgtcggcggatttgcc
gcggccctggctgccggcaagagcgaagccgaggccatccgctttggccaggtggctgcg
gcgctgtcggtgacgcgcgccggtgcgcaaccttccattcccacgctgtccgacgttcag
gcgtttatcccttcatga

DBGET integrated database retrieval system