KEGG   Pseudomonas protegens Pf-5: PFL_2258Help
Entry
PFL_2258          CDS       T00249                                 

Gene name
folE2
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00790  Folate biosynthesis
pfl01100  Metabolic pathways
Module
pfl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFL_2258 (folE2)
Enzymes [BR:pfl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PFL_2258 (folE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI OmpH
Motif
Other DBs
NCBI-ProteinID: AAY91531
UniProt: Q4KEG8
Position
2521570..2522214
Genome map
AA seq 214 aa AA seqDB search
MVDHLGGLFFLGTCKELPALPAFRKPCAMHDPLSQHFHGILQGLGEDPTREGLRDTPQRA
SKALRYLCHGYETSLEELVNGALFSSTSDEMVMVQNIELYSLCEHHLLPFIGQAHVAYIP
TGKVLGLSKVARIVDMYARRLQIQETLTRQIAEAIQEVTRAAGVAVVIEARHMCMMMRGV
EKQNSLMNTSVMLGAFRESASTRQEFLQLLRRQP
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgaccacctcggaggcctttttttccttggcacgtgcaaggaattgcccgccctg
ccagcctttcggaagccatgcgccatgcacgatcctctctcccagcactttcacggcatt
ttgcaggggttgggtgaagacccgacccgcgagggcttgcgggacaccccgcagcgagcc
tcaaaagccttgcgttatctgtgccatggttacgaaaccagcctcgaagaactggtcaac
ggtgcgttgttcagctccaccagcgacgagatggtgatggtccagaacatcgagttgtat
tccctgtgcgagcaccatttgctgccgttcattggtcaggctcatgtggcttacatcccc
accggcaaagtgctgggcctgtccaaggtggcgcggatcgtcgacatgtatgcgcgacgc
ctgcagatccaggagaccctcacgcggcagattgccgaggcgatccaggaagtgacccgg
gcggccggggtggcggtggtcatcgaagcgcggcacatgtgcatgatgatgcgcggggtc
gagaagcagaactcgctgatgaacacctcggtaatgctgggggcctttcgcgagtcggcc
agcacccgccaggagtttcttcagctgttgcgcaggcagccttga

DBGET integrated database retrieval system