KEGG   Pseudomonas protegens Pf-5: PFL_2290Help
Entry
PFL_2290          CDS       T00249                                 

Gene name
hemB_1
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PFL_2290 (hemB_1)
Enzymes [BR:pfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PFL_2290 (hemB_1)
Exosome [BR:pfl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PFL_2290 (hemB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2550842..2551816
Genome map
AA seq 324 aa AA seqDB search
MSSQFPEARPRRLRRSEQLRSLFQETEFTLNDLVLPIFVEEEIDDFVPIKSMPGVMRIPE
SRLAGEIERYARAGIKSVMTFGVSHHLDCDGSDTWKENGLVSRMSRIAKDAVPEMIVMSD
TCFCEYTDHGHCGVMHGHEVDNDQTLLNLGKQAVAAARAGADVIAPSAAMDGQVQAIRRA
LDAAGFTQTPIMAYSTKFASALYGPFREAGGSALKGDRKSYQMNPMNRREAVRESLLDEQ
EGADSLMVKPAGAYLDIIRDIREASRLPVAAYQVSGEYAMIKFGAQAGAIDEPRVVRETL
GSIKRAGADLIFTYFAMDLALAGI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccagttcccagaagcccgtccgcgtcgcctgcgtcgctccgaacaactgcgc
agcctgttccaggaaaccgaattcaccctcaacgacctggtgctgccgattttcgtcgag
gaagaaatcgacgatttcgtgccgatcaagagcatgcccggggtgatgcgcattcccgaa
tccaggttggccggcgagatcgagcgctacgcccgcgccgggatcaagtcggtgatgacc
ttcggcgtctcccaccacctggactgcgacggcagcgatacctggaaggaaaacggcctg
gtgtcgcgcatgtcgcgcatcgccaaggatgcggtgccggagatgatcgtgatgtccgac
acctgcttctgcgaatacaccgatcacggccactgcggggtcatgcacggccatgaagtg
gacaacgaccagaccctgctcaacctcggcaagcaggcggtggctgcggcccgtgccggc
gccgatgtgatcgcgccgtcggcggccatggacggtcaggtccaggccatccgccgcgcc
ctggatgccgccggcttcacccagacgccgatcatggcctattccaccaagttcgcctcg
gcgctctatggcccgttccgtgaagccggcggcagcgcgctcaagggcgatcgcaagagc
taccagatgaacccgatgaaccgccgcgaagcggtgcgcgagtccttgctggacgagcag
gaaggcgccgactcgctgatggtcaagcccgccggggcctacctggacatcatccgcgac
atccgcgaggcctcgcgtctgccggtggcggcgtaccaggtcagcggcgagtacgcgatg
atcaagttcggcgcccaggccggcgccatcgacgagccgcgagtggtgcgcgaaaccctg
ggttcgatcaagcgcgccggcgccgatctgatcttcacctacttcgccatggacctggcc
ctggccgggatctga

DBGET integrated database retrieval system