KEGG   Pseudomonas protegens Pf-5: PFL_2466Help
Entry
PFL_2466          CDS       T00249                                 

Definition
isochorismatase (EC:3.-.-.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pfl00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2728922..2729569
Genome map
AA seq 215 aa AA seqDB search
MNSQTMKTASFDVDAQKSFTPLCPDELPVAEGDRIGGELNFMATLASLRIGSKDAHSPQA
PWVVAGHAQMLQPTGLEHADLTWVSHCVPGTEGFTLLDELPAPYDYDYFVWKGVEPDLHP
YGACYHDLHGKLSTGVIEYLKGQGVQQVIVGGLALDFCVKTTALQLAAAGFKVLIHLPAC
RAISAEGATQAIADMQQAGITVAATREETARLAKV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaacagccaaacgatgaagaccgcttccttcgatgtcgatgcacaaaagagctttacc
ccgctgtgcccggacgagttgcccgtggctgaaggcgatcgcatcggcggcgagctgaat
ttcatggcgaccctcgccagcctgcgtatcggcagcaaggacgcccacagcccccaggcg
ccctgggtggtggccgggcacgcccagatgctccagcccacgggccttgaacatgccgat
ctgacctgggtcagccactgcgttccgggcactgaaggcttcacccttttggacgaactg
cctgcgccctatgactacgactacttcgtgtggaagggcgtggagcctgacctgcacccc
tatggcgcctgctaccacgacctgcacggcaagctgtccaccggggtcatcgagtacctc
aagggccagggcgtacagcaagtcatagtcggcggcctggcgttggatttctgcgtcaag
accactgccctgcaactggccgctgccggtttcaaggtgctcattcacctgccggcgtgc
cgggccatcagcgccgagggcgctacccaggccatcgccgacatgcaacaagcgggcatc
acggttgccgcgacccgcgaagaaaccgccagattggccaaggtttga

DBGET integrated database retrieval system