KEGG   Pseudomonas protegens Pf-5: PFL_2466Help
Entry
PFL_2466          CDS       T00249                                 

Definition
isochorismatase (EC:3.-.-.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PFL_2466
Enzymes [BR:pfl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PFL_2466
    3.5.1.-  
     PFL_2466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2728922..2729569
Genome map
AA seq 215 aa AA seqDB search
MNSQTMKTASFDVDAQKSFTPLCPDELPVAEGDRIGGELNFMATLASLRIGSKDAHSPQA
PWVVAGHAQMLQPTGLEHADLTWVSHCVPGTEGFTLLDELPAPYDYDYFVWKGVEPDLHP
YGACYHDLHGKLSTGVIEYLKGQGVQQVIVGGLALDFCVKTTALQLAAAGFKVLIHLPAC
RAISAEGATQAIADMQQAGITVAATREETARLAKV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaacagccaaacgatgaagaccgcttccttcgatgtcgatgcacaaaagagctttacc
ccgctgtgcccggacgagttgcccgtggctgaaggcgatcgcatcggcggcgagctgaat
ttcatggcgaccctcgccagcctgcgtatcggcagcaaggacgcccacagcccccaggcg
ccctgggtggtggccgggcacgcccagatgctccagcccacgggccttgaacatgccgat
ctgacctgggtcagccactgcgttccgggcactgaaggcttcacccttttggacgaactg
cctgcgccctatgactacgactacttcgtgtggaagggcgtggagcctgacctgcacccc
tatggcgcctgctaccacgacctgcacggcaagctgtccaccggggtcatcgagtacctc
aagggccagggcgtacagcaagtcatagtcggcggcctggcgttggatttctgcgtcaag
accactgccctgcaactggccgctgccggtttcaaggtgctcattcacctgccggcgtgc
cgggccatcagcgccgagggcgctacccaggccatcgccgacatgcaacaagcgggcatc
acggttgccgcgacccgcgaagaaaccgccagattggccaaggtttga

DBGET integrated database retrieval system