KEGG   Pseudomonas protegens Pf-5: PFL_3064Help
Entry
PFL_3064          CDS       T00249                                 

Gene name
fadB1x
Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PFL_3064 (fadB1x)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PFL_3064 (fadB1x)
   00650 Butanoate metabolism
    PFL_3064 (fadB1x)
  Lipid metabolism
   00071 Fatty acid degradation
    PFL_3064 (fadB1x)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFL_3064 (fadB1x)
   00310 Lysine degradation
    PFL_3064 (fadB1x)
   00360 Phenylalanine metabolism
    PFL_3064 (fadB1x)
   00380 Tryptophan metabolism
    PFL_3064 (fadB1x)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PFL_3064 (fadB1x)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PFL_3064 (fadB1x)
   00281 Geraniol degradation
    PFL_3064 (fadB1x)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PFL_3064 (fadB1x)
   00627 Aminobenzoate degradation
    PFL_3064 (fadB1x)
   00930 Caprolactam degradation
    PFL_3064 (fadB1x)
Enzymes [BR:pfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PFL_3064 (fadB1x)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3530660..3531433)
Genome map
AA seq 257 aa AA seqDB search
MSYETILLDIKGRVGLITLNRPQALNALNAQIVGEVNQALDRLEADPQIGCIVITGSKKA
FAAGADIKEMAELSYPQIYLDDLFSDSDRVANRRKPIIAAVNGFALGGGCELALMCDFIL
AGDNAKFGQPEINLGVLPGMGGTQRLTRAVGKAKAMEMCLTGRFIDAVEAERCGIVARIV
PADELVEEALKVAAVIAGKSIPVSMMIKESVNRAFEVSLSEGVRFERRVFHAAFATQDQK
EGMAAFIAKRDPQFKDQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgaaaccattctgttggacatcaagggccgggtcggcctgatcactctcaac
cgcccccaggcgctgaacgccctcaatgcacagatcgtcggcgaggtgaaccaggccctg
gatcgcctggaagccgacccgcagatcggctgcatcgtcatcaccggttccaagaaagcc
ttcgccgccggtgccgacatcaaggaaatggccgagctgagctacccgcagatctacctc
gacgacctgttcagcgacagcgaccgcgtggccaaccggcgcaagccgatcatcgccgcg
gtcaacggcttcgccctgggcggcggttgcgaactggcgctgatgtgcgacttcatcctg
gccggcgacaacgccaagttcggccaaccggaaatcaacctcggcgtgctgccgggcatg
ggcggcacccagcgcctgacccgcgcggtaggcaaggccaaggccatggaaatgtgcctg
accgggcgttttatcgacgccgtggaagctgagcgttgcggcatcgtcgcacgcatcgtg
ccggccgatgaactggtggaagaagccctgaaagtggcagcggtgattgccggcaaatcg
atcccggtgagcatgatgatcaaggaaagcgtgaaccgcgcctttgaagtcagcctgtcc
gagggcgtgcgcttcgagcgccgggtattccacgccgccttcgccacccaggaccagaaa
gaaggcatggccgccttcatcgccaagcgtgacccgcagttcaaggaccagtaa

DBGET integrated database retrieval system