KEGG   Pseudomonas protegens Pf-5: PFL_3159Help
Entry
PFL_3159          CDS       T00249                                 

Gene name
glsA
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pfl00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pfl00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:pfl00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3634623..3635531)
Genome map
AA seq 302 aa AA seqDB search
MQDLLNQILDEVRPLIGQGQVANYIPALADVPANQLGIAVYGNDGQVFSAGDADTPFSVQ
SISKVFSLVQAIGHSGEAIWERLGHEPSGQPFNSLVQLEFERGRPRNPFINAGALVICDI
NQSRFAAPALSMRDFVRRLSGNLQVMVDGRVAESEYQHRARNAAMAYLMQSFGNFHNDVE
AVLRSYFSHCALRMSCVDLARAFCFLANDGFCKHSGEQILTRRQTQQVNSIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIVAVVPGQFTVCVWSPELNSAGNSLVGMAALELLSQRIGWS
VF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacctgttgaaccagattctcgatgaagtccgccccctgatcggccaaggccag
gtggccaattacattccggccctggcggatgtgccggccaatcagttgggcattgccgtg
tatggcaacgacggccaggtgttcagcgccggtgacgccgatacgccgttctcggtgcag
agcatttccaaggtcttcagcctggtgcaggccatcggtcattccggcgaggcgatctgg
gagcgcctgggccacgagccctcggggcagccgttcaattccctggtgcaactggaattc
gagcgtggccggccgcgcaaccccttcatcaatgccggggccctggtgatctgcgacatc
aaccagtcgcgctttgccgcgccggccttgtccatgcgcgactttgtccggcgcctgtcg
ggcaacctgcaggtgatggtggacggtcgggtggccgagtcggagtaccagcaccgcgcc
cgcaacgcggccatggcctacctgatgcagtccttcggcaactttcacaatgatgtggag
gcggtgctgcgcagttacttcagccactgcgccttgcgcatgagctgcgtggatctggcc
cgggccttctgtttcctggccaacgacggcttctgcaagcacagcggggagcagattctc
acccggcgccagacccagcaggtcaactcgatcatggccaccagcggcctgtacgacgag
gccggcaacttcgcctatcgggtcggcctgccgggcaagagcggggtgggcgggggaatt
gtggcggtggtgccggggcagttcacggtctgcgtctggtcgccggagctcaacagcgcc
ggcaactcgctggtgggcatggcggccctggaactgctcagccagcgtatcggctggtcg
gtgttctag

DBGET integrated database retrieval system