KEGG   Pseudomonas protegens Pf-5: PFL_3210Help
Entry
PFL_3210          CDS       T00249                                 

Gene name
aprA
Definition
extracellular alkaline metalloprotease AprA (EC:3.4.24.-)
Orthology
K01406  
serralysin [EC:3.4.24.40]
Organism
pfl  Pseudomonas protegens Pf-5
Brite
Enzymes [BR:pfl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.40  serralysin
     PFL_3210 (aprA)
Peptidases [BR:pfl01002]
 Metallo Peptidases
  Family M10
   PFL_3210 (aprA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3701507..3702955)
Genome map
AA seq 482 aa AA seqDB search
MSKVTENAIASAEQQLVPLAAASSAYNQINSFSHQYDRGGNLTVNGKPSFSVDQAATQLL
RDGAAYKDLNGNGKIDLTYTFLTSASSSTMYKHGISGFSQFSAQQKAQAVLAMQSWADVA
NVVFTEKASGGDAHMTFGNYSGGQDGAAAFAYLPGTGAGYDGTSWYLINSSYTQNKNPDL
NNYGRQTLTHEIGHTLGLAHPGDYNAGEGNPSYKDASYGQDTRGYSVMSYWSESNTSQNF
SKGGVEAYSSGPLMDDIAAIQKLYGANYSTRAGDTTYGFNSNTGRDFYSASSSSDKLVFS
VWDGGGNDTLDFSGFTQNQKINLNEASFSDVGGMVGNVSIAQGVTVENAIGGSGNDLLIG
NNAANVLKGGAGNDIIYGAGGADQLWGGSGSDTFVFAASTDSKPGAADQIMDFVSGLDKI
DLTGITKGAGLHFVNAFTGAAGDAILTTSGGVSTLSVDFSGHGVADFLVSTVGQAAVSDI
VA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagtaacagagaacgctattgcatctgccgaacaacaactggtgcctttggcc
gcagcaagttcggcgtataaccagatcaatagcttcagccaccaatacgatcgtggcggc
aatctcacggtcaatggcaaaccttcgttctcggtcgatcaggccgccacgcaactgctg
cgtgacggcgctgcctataaggacctgaacggtaacggcaagatcgatctgacctatacc
ttcctgacctcggcttcctcgagcaccatgtataagcatggcatctccgggttcagccag
ttcagcgcccagcagaaggcccaggcagtcctggccatgcagtcctgggctgacgtggcc
aacgtcgtgtttaccgagaaagcctcgggtggcgacgcccacatgaccttcggcaactac
agcggtggccaggatggcgcggcggcatttgcctacctgccaggtaccggcgccggctac
gacggcacctcgtggtacctgatcaacagcagctacacccagaacaagaaccccgacctg
aacaactatggccgtcagaccctgacccatgagatcggtcacaccctgggcctggctcac
cctggcgactacaacgccggcgaaggcaaccccagctacaaggacgccagctacggccag
gacacccgtggctacagcgtcatgagctactggagtgaaagcaataccagccagaacttc
agtaagggcggggtcgaagcctattcgtccggcccgctgatggacgatatcgcggctatc
cagaaactctacggtgccaactacagcacccgtgccggcgataccacctacggcttcaac
tccaacaccgggcgtgatttctacagcgccagctcgtcttccgacaagctggtgttctcg
gtgtgggacggtggcggcaacgataccctggatttctccggtttcacccagaaccagaag
atcaacctcaatgaagcctcgttctccgacgttggcggcatggtgggtaacgtttccatc
gctcagggcgtgaccgtggagaacgccatcggcggttcgggcaacgacctgttgatcggc
aacaacgccgccaacgtgctcaagggtggtgccggcaacgacatcatctacggcgccggc
ggtgcagatcagctgtggggcggctcgggctcggacaccttcgtgttcgccgccagcacc
gactccaagccgggtgcggccgaccagatcatggattttgtcagcggcctggacaagatc
gatctgaccgggatcaccaagggagccggcctgcacttcgtcaacgccttcaccggcgcg
gcgggtgacgcgatcctcaccacctccgggggtgtgagcaccttgtccgtggacttctcc
gggcatggcgtggcggacttcctggtcagcaccgtgggccaggcagcggtcagcgacatc
gtcgcctga

DBGET integrated database retrieval system