KEGG   Pseudomonas protegens Pf-5: PFL_3267Help
Entry
PFL_3267          CDS       T00249                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00071  Fatty acid degradation
pfl00280  Valine, leucine and isoleucine degradation
pfl00281  Geraniol degradation
pfl00310  Lysine degradation
pfl00360  Phenylalanine metabolism
pfl00362  Benzoate degradation
pfl00380  Tryptophan metabolism
pfl00410  beta-Alanine metabolism
pfl00627  Aminobenzoate degradation
pfl00640  Propanoate metabolism
pfl00650  Butanoate metabolism
pfl00903  Limonene and pinene degradation
pfl00930  Caprolactam degradation
pfl01100  Metabolic pathways
pfl01110  Biosynthesis of secondary metabolites
pfl01120  Microbial metabolism in diverse environments
pfl01130  Biosynthesis of antibiotics
pfl01212  Fatty acid metabolism
Module
pfl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PFL_3267
   00650 Butanoate metabolism
    PFL_3267
  Lipid metabolism
   00071 Fatty acid degradation
    PFL_3267
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFL_3267
   00310 Lysine degradation
    PFL_3267
   00360 Phenylalanine metabolism
    PFL_3267
   00380 Tryptophan metabolism
    PFL_3267
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PFL_3267
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PFL_3267
   00281 Geraniol degradation
    PFL_3267
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PFL_3267
   00627 Aminobenzoate degradation
    PFL_3267
   00930 Caprolactam degradation
    PFL_3267
Enzymes [BR:pfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PFL_3267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AAY92536
UniProt: Q4KBL1
Position
complement(3772163..3772975)
Genome map
AA seq 270 aa AA seqDB search
MSEYQAFRVELANNIAHVQINRPEKINAMNAAFWSEIVEIFRWIDDTDAVRVVVLSGAGK
HFSSGIDLMMLAGVANELGKDVGRNARLLRRKIFQLQASFNAVDNCRKPVLAAIQGYCLG
GAIDLISACDMRYAADDAQFSIKEIDIGMAADVGTLQRLPRIIGDGILRELAYTGRTFGA
EEARSIGLVNRTYSDAASLLDGVMGIAREIAAKSPIAVSGTKEMLSYMRDHRIDDGLEYV
ATWNAAMLQSNDLRVAIAAHMSKQKPEFLD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaataccaagcctttcgcgtcgaactcgctaacaacatcgcccatgtgcagatc
aaccgcccggaaaagatcaacgccatgaacgccgcgttctggagcgagatcgtcgagatc
ttccgctggatcgacgacactgacgcagtgcgcgtggtggtgctcagcggtgccggcaag
catttctcttcgggcatcgacctgatgatgctggccggggtggccaacgaactgggcaag
gatgtgggccgcaacgcgcgcctgctgcggcgcaagatcttccagctgcaagcctcgttc
aacgccgtggacaactgccgcaagccggtgctggcggcgatccagggctattgcctgggg
ggcgccatcgacctgatcagcgcctgcgacatgcgttacgccgcggacgatgcgcaattc
tcgatcaaggaaatcgatatcggcatggctgcggatgtcggcacactgcaacgtttgcca
cgtatcatcggcgacggcatcctgcgcgagctggcctacactgggcgcaccttcggtgcc
gaggaagcacgcagcattggcctggtcaaccggacctacagcgatgccgcaagcctgctg
gacggggtcatgggaattgcccgggagatcgccgccaagtcgccgatcgcggtcagcggc
accaaggaaatgctcagctacatgcgtgaccaccgtattgatgacggcctggaatatgtc
gccacctggaacgctgccatgttgcagtccaacgacttgcgcgtggccatcgccgcccac
atgagcaaacagaaacccgaatttctggattga

DBGET integrated database retrieval system