KEGG   Pseudomonas protegens Pf-5: PFL_3326Help
Entry
PFL_3326          CDS       T00249                                 

Gene name
ccpA_1
Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pfl  Pseudomonas protegens Pf-5
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3840732..3841727
Genome map
AA seq 331 aa AA seqDB search
MTTDQPRQPPRRRARVLLLLLWAGLGATSPSAFAAPLDEPLKPLPAPPALDPQRVELGRQ
LFNEPRLSQDHSLSCASCHRLDQGGADSQAKSPGFKGQPTRVNTPSVFNAALNFRQFWDG
RVESLEAQIDSVVQSPSEMGNTWPALIRTLSDDSAYQKSFGALYPDGITAANVQNALATY
EKTLLSANSRFDQYLQGNTDILSLEEKYGYQRFKDYGCIACHQGVNIGGNMFQKFGVMGD
YFAARGNPTDADLGRFLVTGDEQDRNVFKVPSLRNVAVTAPYFHDGSAPTLEQAVEVMFK
YQLGRPPNTQDISLIVKFLKTLTGEWQGKPL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgaccaaccgcgccagccgccgcgccgccgcgcacgggtactgctcctgctg
ctctgggcagggctgggcgccaccagcccgagcgcttttgccgcgcccctggacgaaccg
ctcaagccgttgcccgcaccgccggcactcgacccccagcgggtcgagctcgggcgccag
ctgttcaacgaaccgcgcctgtcccaggaccacagcctgtcctgtgccagctgccaccgg
ctggaccagggcggggccgactcccaggcaaaatcgccgggtttcaaggggcagcctacc
cgggtcaacacccccagcgtgttcaatgccgcgctgaatttccggcagttctgggacggg
cgcgtcgaatccctggaagcgcagatcgacagcgtcgtgcaaagccccagcgagatgggc
aacacctggccggcgctgatccgcaccttgagcgatgacagcgcctaccagaagtccttc
ggtgccctgtacccggacggcatcaccgcagccaacgtgcaaaatgccctggccacctat
gaaaagaccttgctcagcgccaactcgcggttcgaccagtacctgcaaggcaataccgac
atcctcagcctggaagaaaaatacggttaccagcgcttcaaggattacggctgcatcgcc
tgccaccagggggtcaatatcggcggcaacatgtttcagaagttcggcgtgatgggcgac
tacttcgctgcccggggcaaccccaccgacgccgacctggggcgcttcctggtcaccggc
gacgaacaggaccgcaacgtgttcaaggtgcccagcctgcgcaatgtcgcagtgactgcg
ccctacttccatgacggttcggcgccgaccctggagcaggctgtggaagtcatgttcaag
tatcagctggggcgcccgcccaatacccaggacatcagcctgatcgtcaagtttctcaag
accctgaccggcgaatggcagggcaagcccttatga

DBGET integrated database retrieval system