KEGG   Pseudomonas protegens Pf-5: PFL_3653Help
Entry
PFL_3653          CDS       T00249                                 

Gene name
bchI
Definition
magnesium chelatase subunit BchI (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pfl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4221398..4222405)
Genome map
AA seq 335 aa AA seqDB search
MSDTPHFPLSAVVGAEALKLALCLTAIDPKIGGVLIEGPRGMAKSTLARGLADLLASGQF
VTLPLGATEERLVGTLDLDAALGQGRAQFSPGVLAKADGGVLYVDEVNLLPDHLVDLLLD
VAASGTNLIERDGISHRHSAKFVLIGTMNPEEGELRPQLLDRFGLNVALSGQPAPQERGQ
IIRRRLDFDSDPQGFCAQWAEPQTALRERCQQARAALASIPLDDQALALITERCFAAAVD
GLRADLVWLRAARAHAAWRGAPAIAEEDIDAVAEFALRHRRRETPPSAPQSGQSPQAPAP
SNANPSEGQGQWGEMPAQALPTGARREVPSWPKKP
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaccccacatttcccgctgtccgccgtggtcggcgccgaagcactgaaactg
gccctgtgcctgaccgccatcgacccgaagatcggcggcgtgctgatcgaaggcccacgg
ggcatggccaagtcgaccctggcccggggcctggcggacctgttggccagcgggcagttc
gtcaccttgcccctgggcgccaccgaagagcgtctggtgggcaccctggacctggacgcc
gccctgggccagggccgggcgcaattttctccgggggtgctggccaaggccgacggcggc
gtgctctacgtcgatgaagtcaacctgctgcctgaccacttggtggacctgttgctggac
gtggccgccagcggcaccaacctgatcgagcgcgacggtatttcccaccgccattcggcg
aagttcgtgctgatcggcaccatgaacccggaggagggcgaactgcgtccgcaactgctg
gaccgttttggcctcaacgtcgccctcagcggccagcccgcgccccaggagcgcgggcag
atcattcgccgccgcctggatttcgacagcgatccccagggcttctgcgcccagtgggcc
gaaccccagacggcattgcgcgagcgctgccaacaggcgcgggccgccctggccagcatc
ccgctggacgaccaggccctggcgctgattaccgagcgctgctttgctgctgccgtggac
ggcctgcgcgccgacctggtctggctgcgcgcggcccgcgcccatgccgcctggcgtggc
gccccggcgattgccgaggaggatatcgacgccgtggccgagttcgccttgcgccaccgg
cggcgggagacaccgcccagcgcgccacagtccgggcaaagcccccaggcaccggcgcca
tccaacgccaaccccagcgaaggccagggccaatggggcgaaatgccggcccaggccctg
cccaccggcgcccgtcgtgaagtgcccagctggccaaaaaagccctag

DBGET integrated database retrieval system