KEGG   Pseudomonas protegens Pf-5: PFL_3811Help
Entry
PFL_3811          CDS       T00249                                 

Definition
(GenBank) putative threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00260  Glycine, serine and threonine metabolism
pfl00750  Vitamin B6 metabolism
pfl01100  Metabolic pathways
pfl01110  Biosynthesis of secondary metabolites
pfl01120  Microbial metabolism in diverse environments
pfl01230  Biosynthesis of amino acids
Module
pfl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pfl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PFL_3811
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PFL_3811
Enzymes [BR:pfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PFL_3811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AAY93075
UniProt: Q4KA22
Position
complement(4409773..4411149)
Genome map
AA seq 458 aa AA seqDB search
MRYVSTRSTAEQVDFESVVLSGVAADGGLYVPAELPRFSPQEIANWSTLDYPELAFRVLS
PFVGDCLPEADFKALLSRAYSGFGHRAVAPLRQIDRNEWVLELFHGPTGSAKDFAARLQA
QLVGYFLQRRQRHGVLVGASNGDTALAAIDAFKDCPQTQVLVFYPQHGVPEQQGQQLQAA
HNPGLWRFAVQGSFDDCQTLVARLLRQWPLAEREVIGFNSSNWVGVMAQLVLYFHAVLQL
GGGQRPIGFSVPAASFAEVYAGYIVQKMGLPITQMIVATNRNDALHQLFLKNRYCRAEAS
QSLSPAMDLSLFANLERFVWELYGQDPHAVAGLMQRFEGSGEMTLGNEFWLQARMIIDSY
SVSDEETGKEISSLYRDTGYIIDPHAAIGVLAARLYRRSLVAPMVTLGEIAPAKSARLLG
SLGIPGLAPQPLAAPSTAQWQALAADDFAAVLHCLKAL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatgtgagtacccgcagtaccgccgagcaggtggatttcgaaagcgtggtgtta
tccggcgtggccgccgatggcgggctgtacgtgcctgccgagctgccacgcttcagcccc
caggagatcgccaattggtcgaccctggattaccccgaactggccttccgggtgctcagc
ccctttgtgggcgactgcctgcccgaggcggacttcaaggccttgctcagccgcgcctac
agcggctttggccaccgcgcggtggcgcccctgcgacagatcgaccgcaatgaatgggtg
ctggaactgttccatgggcccacaggctcggccaaggattttgccgcgcggttgcaggcg
caactggtgggctatttcctccagcgccggcagcgccacggggtgctggtgggggccagc
aacggcgataccgcgctggcggctatcgacgccttcaaggactgcccgcagacccaggtg
ctggtgttctatccgcagcacggcgtgcccgagcagcaagggcagcagttgcaggcggca
cacaaccccgggctgtggcgctttgccgtgcagggcagcttcgacgactgccagaccctg
gtggcccgcctgctgcgccaatggcccctggccgagcgcgaggtgatcggcttcaactcc
agcaattgggtcggggtcatggcccagctggtgctgtatttccatgccgtgctgcaactg
gggggcggccagcggcccatcggtttcagcgtgccggcggccagcttcgccgaggtctat
gccggctatatcgtgcagaagatgggcctgcccatcacccagatgattgtcgccaccaac
cgcaacgacgccctgcaccagctgttcctgaagaaccgctattgtcgcgccgaggccagc
cagagcctgtcgccggccatggacctgtcgctgttcgccaacctggagcgctttgtctgg
gagctctatggccaggacccgcatgcggtggcgggcctgatgcagcgctttgaaggcagt
ggcgagatgaccctgggcaacgagttctggctgcaggcgcggatgatcatcgactcctac
tcggtgagcgatgaagagaccggcaaggagatcagcagcctctatcgggacaccggctac
atcatcgacccccatgctgccatcggtgtcctggcggcgcgcctgtaccgccgcagcctg
gtggcgcccatggtcaccctgggggagatcgcgccggccaagtcggctcggttgctgggc
tcgctgggtattcccgggctggcaccgcagccactcgcggcgccttccacggcgcagtgg
caggcactggcagcggatgattttgccgccgtactgcactgcctgaaggcactgtga

DBGET integrated database retrieval system